Lus10026891 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26820 156 / 2e-45 ATPP2-A3 phloem protein 2-A3 (.1)
AT1G33970 146 / 2e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
AT1G33960 144 / 2e-41 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G09940 144 / 2e-41 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33950 141 / 8e-41 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2)
AT1G33930 140 / 4e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33830 132 / 2e-38 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33910 133 / 5e-38 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G09930 131 / 7e-37 Avirulence induced gene (AIG1) family protein (.1)
AT4G09950 131 / 9e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005300 219 / 5e-70 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10005299 184 / 3e-56 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10003732 149 / 1e-43 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10028023 138 / 3e-40 AT4G09940 181 / 2e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009482 115 / 1e-31 AT1G33970 148 / 9e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10009485 98 / 1e-25 AT1G33970 142 / 2e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10009483 78 / 2e-18 AT1G33970 91 / 3e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10003507 74 / 2e-17 AT1G33930 82 / 3e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009484 69 / 2e-13 AT4G26220 255 / 1e-83 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G104800 196 / 6e-62 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.019G077300 194 / 4e-61 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.009G131200 45 / 2e-05 AT3G16620 1129 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
Potri.004G171600 45 / 2e-05 AT3G16620 1128 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
Potri.009G131300 42 / 0.0002 AT3G16620 1111 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF04548 AIG1 AIG1 family
Representative CDS sequence
>Lus10026891 pacid=23142888 polypeptide=Lus10026891 locus=Lus10026891.g ID=Lus10026891.BGIv1.0 annot-version=v1.0
ATGGAAAATGAGAAGGAGTTGGTTACACCTTATAATACTGGTGTTGGAACCGTCGTTTTATGTGGACGTACTGGTAACAGGAAGAGTGCTACCGGGAACA
CCATTCTCGTCGAAAAGTGCTTCAAGTCTATGGTCAGTTCATCTGCTGTCACAACTTGCTACGATTTGCAGACGACTCTTATAGAAGATGGTCAAATCTT
AAACGTCATCGACACTCCTGCACTGCTTGGAAGTTGCGTTGAATCTGATTCTCTTGGCAAGGCAATCGTAAATATGGCCAGAAACAAGATCCCTGCAGTC
ATTCTTGTGTTATCATTAAGCAATCGCTTCACGGAAGAGGAAGAAGCAGCAATTCGTTGCCTCCAGTGTTTGTTCGGACGAAAGATAATGTACTACACGA
TTGTAGCGTTCACCGGTAGAGATAAACTTGAGGAGGAGGGTATTAAAACTTTGAATGAGTATTTATTTGGGTCGCAACTGTCCTCGGTCGTTAAAGAGTT
GTATGGATCGATGCCGGAAATTCTAGCACTTTGCGACAATCGGATGCTGCTGTTTGATAACCACACGAACGATGAAGTCAATAGAGTCGAACAGGTTAGG
CAGCTAATGACACTAGTAGACGGAATCGCTGTGCAGAATGGCGGGGAGTAA
AA sequence
>Lus10026891 pacid=23142888 polypeptide=Lus10026891 locus=Lus10026891.g ID=Lus10026891.BGIv1.0 annot-version=v1.0
MENEKELVTPYNTGVGTVVLCGRTGNRKSATGNTILVEKCFKSMVSSSAVTTCYDLQTTLIEDGQILNVIDTPALLGSCVESDSLGKAIVNMARNKIPAV
ILVLSLSNRFTEEEEAAIRCLQCLFGRKIMYYTIVAFTGRDKLEEEGIKTLNEYLFGSQLSSVVKELYGSMPEILALCDNRMLLFDNHTNDEVNRVEQVR
QLMTLVDGIAVQNGGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G26820 ATPP2-A3 phloem protein 2-A3 (.1) Lus10026891 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10037323 1.0 0.8990
Lus10019981 6.9 0.8896
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10017170 8.7 0.8211
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10025506 9.8 0.8676
AT1G76520 Auxin efflux carrier family pr... Lus10013200 16.0 0.8531
AT4G34480 O-Glycosyl hydrolases family 1... Lus10039923 16.6 0.6067
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Lus10015748 17.1 0.6592
AT1G04670 unknown protein Lus10004041 18.2 0.8487
AT5G60010 ferric reductase-like transmem... Lus10019390 19.9 0.8487
Lus10027066 21.5 0.8487

Lus10026891 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.