Lus10026898 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25770 127 / 3e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT4G32870 99 / 6e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005477 217 / 1e-73 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10000573 88 / 1e-22 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10006042 76 / 3e-18 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028262 52 / 8e-09 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 50 / 3e-08 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G046100 147 / 3e-46 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G236800 96 / 2e-25 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237000 87 / 1e-22 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 87 / 2e-22 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G063900 50 / 2e-08 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10026898 pacid=23142832 polypeptide=Lus10026898 locus=Lus10026898.g ID=Lus10026898.BGIv1.0 annot-version=v1.0
ATGGCAGAAGAAGCCCAACCCAACAACCACCCACTCCCCAAATGGAATGGAAAGGTCCCGGCAACCGTAAAGAGAGCCAGTGCCGACCAAATATGGACGC
TCTTCACAGATTTCTTCAACATCCACAGATGGTTCTCAAACCTTCCATCCAGCTATATGGGAATCCACGACAGCAATGGCCAGCCGGGCTGCATCCGCTA
CTGCTCGGGCTTCACCCTTCCCTCTACCCAGCTTCTTACCTGGTCCAAGGAAAGATTGAACGCCGTCGATCACTCCGAGATTGTCGACTGCAACATCGGA
TTCAAGTCCTATGCATCGACGGTCCAGAATTTTCCGGATGATGATGATGACCAAGGATGTTTGATCGAGTGGGGGTTCACAGTAGATCCCGTGGAAGTTT
TGTCTGACAATTACTGA
AA sequence
>Lus10026898 pacid=23142832 polypeptide=Lus10026898 locus=Lus10026898.g ID=Lus10026898.BGIv1.0 annot-version=v1.0
MAEEAQPNNHPLPKWNGKVPATVKRASADQIWTLFTDFFNIHRWFSNLPSSYMGIHDSNGQPGCIRYCSGFTLPSTQLLTWSKERLNAVDHSEIVDCNIG
FKSYASTVQNFPDDDDDQGCLIEWGFTVDPVEVLSDNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25770 Polyketide cyclase/dehydrase a... Lus10026898 0 1
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10027161 6.1 0.6090
AT3G07200 RING/U-box superfamily protein... Lus10018271 13.7 0.5579
AT2G34440 MADS AGL29 AGAMOUS-like 29 (.1) Lus10011787 16.7 0.5635
AT1G08580 unknown protein Lus10000388 21.4 0.5171
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10040325 43.0 0.5056
AT3G13690 Protein kinase protein with ad... Lus10009559 43.4 0.5121
AT4G27570 UDP-Glycosyltransferase superf... Lus10013367 45.8 0.5111
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10040652 46.6 0.5187
AT1G73190 ALPHA-TIP, TIP3... ALPHA-TONOPLAST INTRINSIC PROT... Lus10036187 50.1 0.4842
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10010474 51.8 0.5008

Lus10026898 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.