Lus10026899 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24860 154 / 5e-49 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
AT3G47650 42 / 3e-05 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
AT5G17840 39 / 0.0005 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020093 107 / 3e-29 AT2G24860 57 / 2e-10 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10005719 45 / 1e-06 AT3G47650 130 / 4e-40 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10002906 44 / 3e-06 AT3G47650 109 / 1e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10002040 44 / 7e-06 AT1G75690 203 / 5e-68 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10019417 43 / 2e-05 AT3G47650 128 / 2e-38 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10030091 42 / 3e-05 AT3G47650 129 / 3e-39 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G266800 181 / 1e-59 AT2G24860 167 / 3e-54 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G016400 175 / 3e-57 AT2G24860 165 / 5e-53 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G068300 44 / 5e-06 AT3G47650 140 / 9e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.005G237800 41 / 6e-05 AT1G75690 182 / 8e-60 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G028500 40 / 0.0001 AT3G47650 120 / 4e-36 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.013G066000 39 / 0.0005 AT5G17840 145 / 4e-45 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.002G023600 39 / 0.0005 AT1G75690 193 / 4e-64 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026899 pacid=23142959 polypeptide=Lus10026899 locus=Lus10026899.g ID=Lus10026899.BGIv1.0 annot-version=v1.0
ATGCCGTCGATTGGGCCTAAATCGCCGACCGCCACGACCATCTCCACACGTTCTTATGCCGGTCAATCACCAAGTTACCTACTCGGAAGCGCATTTACTG
CAGCGGGGACGGTTTCATGTAGGGTTCTGAGAGTCAGGGCTTCTGCCGTGGATTCGCATGGGAACTCCTCTGATTTCACCAAACGTATGGAGCAGGCTTG
GTCGATATCTAAGCAACCAAGGCCAGTGCCATGTACTTGTTGCGAGTCGAATGGCACCATTGAATGCCAATGGTGTAGAGGAACTGGTTTCTTCATTCTA
GGTGATAACATGCTGTGTCAAGTCCCTTCTAGAAACACCACTTGTGTAATTTGTGCCGGCAAGGGATCCATGCGTTGCGGCGATTGCAAGGGAACTGGGT
TTCGTGCAAAGTGGTTGGGAGAACCCACAGGTTCTAGCTAA
AA sequence
>Lus10026899 pacid=23142959 polypeptide=Lus10026899 locus=Lus10026899.g ID=Lus10026899.BGIv1.0 annot-version=v1.0
MPSIGPKSPTATTISTRSYAGQSPSYLLGSAFTAAGTVSCRVLRVRASAVDSHGNSSDFTKRMEQAWSISKQPRPVPCTCCESNGTIECQWCRGTGFFIL
GDNMLCQVPSRNTTCVICAGKGSMRCGDCKGTGFRAKWLGEPTGSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G24860 DnaJ/Hsp40 cysteine-rich domai... Lus10026899 0 1
AT1G32160 Protein of unknown function (D... Lus10030993 12.2 0.8692
AT1G77490 TAPX thylakoidal ascorbate peroxida... Lus10018155 21.0 0.8505
AT5G03290 IDH-V isocitrate dehydrogenase V (.1... Lus10013806 30.7 0.8468
AT1G32160 Protein of unknown function (D... Lus10000084 31.0 0.8160
AT1G78690 Phospholipid/glycerol acyltran... Lus10004783 31.9 0.8269
AT2G40090 ATATH9 ABC2 homolog 9 (.1) Lus10040196 43.0 0.8274
AT1G32500 ABCI7, ATNAP6 ATP-binding cassette I7, non-i... Lus10017374 50.3 0.8340
AT5G67020 unknown protein Lus10019249 60.6 0.8177
AT5G04830 Nuclear transport factor 2 (NT... Lus10008971 68.2 0.7831
AT1G15750 TPL, WSIP1 WUS-INTERACTING PROTEIN 1, TOP... Lus10006650 75.8 0.7816

Lus10026899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.