Lus10026905 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10770 81 / 1e-18 Eukaryotic aspartyl protease family protein (.1)
AT1G79720 80 / 3e-18 Eukaryotic aspartyl protease family protein (.1)
AT5G10760 78 / 2e-17 Eukaryotic aspartyl protease family protein (.1)
AT2G03200 75 / 2e-16 Eukaryotic aspartyl protease family protein (.1)
AT1G01300 72 / 3e-15 Eukaryotic aspartyl protease family protein (.1)
AT3G20015 71 / 4e-15 Eukaryotic aspartyl protease family protein (.1)
AT2G42980 71 / 9e-15 Eukaryotic aspartyl protease family protein (.1)
AT3G61820 67 / 1e-13 Eukaryotic aspartyl protease family protein (.1)
AT1G25510 66 / 2e-13 Eukaryotic aspartyl protease family protein (.1)
AT3G59080 61 / 1e-11 Eukaryotic aspartyl protease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000265 313 / 3e-108 AT5G10770 173 / 3e-49 Eukaryotic aspartyl protease family protein (.1)
Lus10020099 224 / 5e-73 AT5G10770 149 / 4e-40 Eukaryotic aspartyl protease family protein (.1)
Lus10020100 100 / 9e-26 AT5G10770 190 / 7e-56 Eukaryotic aspartyl protease family protein (.1)
Lus10026906 94 / 3e-23 AT5G10760 182 / 9e-53 Eukaryotic aspartyl protease family protein (.1)
Lus10024098 84 / 1e-19 AT1G79720 399 / 4e-136 Eukaryotic aspartyl protease family protein (.1)
Lus10042426 79 / 8e-18 AT5G10770 553 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10041621 78 / 3e-17 AT1G79720 510 / 1e-178 Eukaryotic aspartyl protease family protein (.1)
Lus10042427 75 / 2e-16 AT5G10770 476 / 7e-165 Eukaryotic aspartyl protease family protein (.1)
Lus10003999 74 / 7e-16 AT1G01300 636 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G185175 89 / 4e-21 AT1G79720 523 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.018G014800 85 / 8e-20 AT5G10770 312 / 9e-102 Eukaryotic aspartyl protease family protein (.1)
Potri.001G041700 85 / 1e-19 AT1G79720 521 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.006G232600 82 / 6e-19 AT5G10770 438 / 1e-150 Eukaryotic aspartyl protease family protein (.1)
Potri.006G232500 82 / 8e-19 AT5G10770 334 / 2e-110 Eukaryotic aspartyl protease family protein (.1)
Potri.018G015100 81 / 2e-18 AT5G10770 483 / 5e-168 Eukaryotic aspartyl protease family protein (.1)
Potri.018G014700 77 / 4e-17 AT5G10770 407 / 1e-138 Eukaryotic aspartyl protease family protein (.1)
Potri.018G014900 77 / 5e-17 AT5G10770 408 / 3e-139 Eukaryotic aspartyl protease family protein (.1)
Potri.016G000600 76 / 8e-17 AT5G10770 286 / 2e-91 Eukaryotic aspartyl protease family protein (.1)
Potri.010G128200 76 / 1e-16 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10026905 pacid=23142859 polypeptide=Lus10026905 locus=Lus10026905.g ID=Lus10026905.BGIv1.0 annot-version=v1.0
ATGTACTTCGTCAATCTCAACGGAATCACCATCGGAGACTTGGTGATCCCCGCTTCTTCTTTGTCGTCGGCGGCGATCGACTCGGGGACTGAAATCAGCC
GGCTCCCGCAGGAGGTGTACGAAGGCGTGAAAGCAGAGTTCAAGAAATGGATGGCGAATTACACGGAAGTAGAGGGATCGGATATTTTGGACACTTGTTA
TGATATGGGCGGAGTGGAGATTAAGAATTTGAAAGTTCCGATTATGGTTCTGCATTTCGGGGATGAGTTGGATATGTATTTGAACGAGGGTAAGGTTGTT
TGGCCGGACAAGGCCCGAAGCGGAGTTGCGTGTTTGGGGTTTGCTGCGGATAATGTCAGCATTATTGGGACTCATCAACACAGTGGCTGGAATCTGCTCT
ACAACAATGAACGCAACACTGTTGCATTCGGCCCCGGAAATTGCTGA
AA sequence
>Lus10026905 pacid=23142859 polypeptide=Lus10026905 locus=Lus10026905.g ID=Lus10026905.BGIv1.0 annot-version=v1.0
MYFVNLNGITIGDLVIPASSLSSAAIDSGTEISRLPQEVYEGVKAEFKKWMANYTEVEGSDILDTCYDMGGVEIKNLKVPIMVLHFGDELDMYLNEGKVV
WPDKARSGVACLGFAADNVSIIGTHQHSGWNLLYNNERNTVAFGPGNC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10760 Eukaryotic aspartyl protease f... Lus10026905 0 1
AT5G10770 Eukaryotic aspartyl protease f... Lus10020099 1.0 0.9737
AT5G10770 Eukaryotic aspartyl protease f... Lus10000265 1.7 0.9594
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10018379 2.4 0.9615
AT5G26340 ATSTP13, MSS1, ... SUGAR TRANSPORT PROTEIN 13, Ma... Lus10041210 3.9 0.9479
AT1G24140 Matrixin family protein (.1) Lus10035221 4.9 0.9476
AT1G10340 Ankyrin repeat family protein ... Lus10038608 5.2 0.9320
AT2G41810 Protein of unknown function, D... Lus10035451 5.5 0.8272
AT5G62230 ERL1 ERECTA-like 1 (.1.2) Lus10027580 5.7 0.9279
Lus10041664 6.3 0.9314
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10015286 6.3 0.9500

Lus10026905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.