Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22360 60 / 3e-12 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22380 57 / 6e-11 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22340 56 / 9e-11 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22370 54 / 5e-10 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G22400 47 / 2e-07 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G78270 41 / 2e-05 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041055 [exp] 91 / 4e-23 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10037262 [exp] 74 / 7e-19 AT1G22380 75 / 2e-17 UDP-glucosyl transferase 85A3 (.1) Lus10032220 [exp] 58 / 2e-11 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10024584 [exp] 56 / 1e-10 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032218 [exp] 55 / 2e-10 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10024583 [exp] 53 / 1e-09 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10013924 [exp] 50 / 2e-08 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10039277 [exp] 49 / 3e-08 AT1G22400 499 / 3e-174 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013925 [exp] 47 / 2e-07 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G052166 [exp] 68 / 7e-15 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G312600 [exp] 68 / 8e-15 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 65 / 6e-14 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052232 [exp] 54 / 7e-10 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 54 / 7e-10 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G020900 [exp] 52 / 2e-09 AT1G22380 538 / 0.0 UDP-glucosyl transferase 85A3 (.1) Potri.016G021000 [exp] 52 / 3e-09 AT1G22360 561 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052100 [exp] 51 / 6e-09 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G021300 [exp] 50 / 1e-08 AT1G22400 522 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G021700 [exp] 50 / 2e-08 AT1G22400 524 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026912 pacid=23142943 polypeptide=Lus10026912 locus=Lus10026912.g ID=Lus10026912.BGIv1.0 annot-version=v1.0 ATGGACTGGATTCTGGCAATGCAAGGAATCCAATGCTTCCCCAATCACATTAGAATCACCGACGCAAACGACACCATGTTCAATTTCCTTCACAGAGAAA TCGACCAGACTTCCAGAGCCTCCGTCGTCATAATGAACACCTTCCACCATCTCGAACAGGAAAGAGTCAGAGTGCCTCCAATGGCTGAACACCAGGGAAC CAAACTCCGTGTCTACGTCAACTTCGGGAGCATAACCGTCGTCACACATTAG
AA sequence Show only first row Show all	>Lus10026912 pacid=23142943 polypeptide=Lus10026912 locus=Lus10026912.g ID=Lus10026912.BGIv1.0 annot-version=v1.0 MDWILAMQGIQCFPNHIRITDANDTMFNFLHREIDQTSRASVVIMNTFHHLEQERVRVPPMAEHQGTKLRVYVNFGSITVVTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10026912 [exp]	0	1
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	2.8	0.8812
AT1G16670			Protein kinase superfamily pro...		Lus10028149 [exp]	3.7	0.8810
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10041898 [exp]	4.9	0.8472
AT5G18100		CSD3	copper/zinc superoxide dismuta...		Lus10010651 [exp]	7.1	0.8704
AT1G67120			ATPases;nucleotide binding;ATP...		Lus10037615 [exp]	9.8	0.8375
AT1G76140			Prolyl oligopeptidase family p...		Lus10034558 [exp]	13.6	0.8427
AT5G60335			Thioesterase superfamily prote...		Lus10028483 [exp]	13.7	0.8144
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	15.7	0.8259
AT4G37020			unknown protein		Lus10000435 [exp]	17.7	0.8207
AT5G18100		CSD3	copper/zinc superoxide dismuta...		Lus10013615 [exp]	18.1	0.8252

Compare expression of checked genes

Lus10026912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.