Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29100 61 / 4e-12 ATGLR2.9 GLUTAMATE RECEPTOR 2.9, glutamate receptor 2.9 (.1) AT2G29120 56 / 2e-10 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) AT2G29110 54 / 1e-09 ATGLR2.8 glutamate receptor 2.8 (.1) AT3G04110 46 / 7e-07 ATGLR1.1, GLR1 glutamate receptor 1.1 (.1) AT3G07520 45 / 1e-06 ATGLR1.4 glutamate receptor 1.4 (.1) AT2G24720 44 / 2e-06 ATGLR2.2 glutamate receptor 2.2 (.1) AT5G48400 44 / 3e-06 ATGLR1.2 GLUTAMATE RECEPTOR 1.2, Glutamate receptor family protein (.1.2) AT2G24710 39 / 0.0002 ATGLR2.3 glutamate receptor 2.3 (.1) AT5G11180 39 / 0.0003 ATGLR2.6 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.6, glutamate receptor 2.6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026877 [exp] 137 / 2e-42 AT2G29110 120 / 9e-32 glutamate receptor 2.8 (.1) Lus10020109 [exp] 127 / 2e-35 AT2G29120 822 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10003436 [exp] 118 / 2e-32 AT2G29120 867 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10026235 [exp] 78 / 5e-18 AT2G29120 912 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G012800 [exp] 66 / 2e-15 AT2G29110 52 / 5e-09 glutamate receptor 2.8 (.1) Potri.018G011800 [exp] 66 / 4e-14 AT2G29110 805 / 0.0 glutamate receptor 2.8 (.1) Potri.018G012300 [exp] 65 / 2e-13 AT2G24720 822 / 0.0 glutamate receptor 2.2 (.1) Potri.018G012000 [exp] 65 / 2e-13 AT2G29110 821 / 0.0 glutamate receptor 2.8 (.1) Potri.018G013200 [exp] 62 / 1e-12 AT2G29120 882 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Potri.018G012100 [exp] 62 / 2e-12 AT2G29120 934 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Potri.018G012600 [exp] 61 / 5e-12 AT2G29120 946 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Potri.006G268450 [exp] 59 / 1e-11 AT5G27100 243 / 8e-75 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.1, glutamate receptor 2.1 (.1) Potri.006G270400 [exp] 59 / 2e-11 AT2G29110 874 / 0.0 glutamate receptor 2.8 (.1) Potri.006G268200 [exp] 58 / 3e-11 AT2G29120 841 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026914 pacid=23142869 polypeptide=Lus10026914 locus=Lus10026914.g ID=Lus10026914.BGIv1.0 annot-version=v1.0 ATGAGCTTGTTCGCTGGAGCTCATGCCTTTATGAACCATGATATTAGTACGGCGCCGATGGCGGCGGAGCAGAGTAACGCAACTGTTGCGGTGAAGGTCG GAGTGATTCTCGACTTGAACGGAAGCCACGACGACCTTGTTGGCCGGGTTGGGCTTAGCTGCATTCAAATGGCAGTTTCAGATTTCTACGCAGTGAATTC AAACTACACCACCCGCCTCCTCATCCACGCCAGGGATTCTCCCGGCGACAACGTCGTTCAGTCTGCTGCTTCAGCTGGCGAGCATAGTGAATCGTGA
AA sequence Show only first row Show all	>Lus10026914 pacid=23142869 polypeptide=Lus10026914 locus=Lus10026914.g ID=Lus10026914.BGIv1.0 annot-version=v1.0 MSLFAGAHAFMNHDISTAPMAAEQSNATVAVKVGVILDLNGSHDDLVGRVGLSCIQMAVSDFYAVNSNYTTRLLIHARDSPGDNVVQSAASAGEHSES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Lus10026914 [exp]	0	1

Compare expression of checked genes

Lus10026914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.