Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020128 [exp] 105 / 2e-29 ND 48 / 6e-07 Lus10020129 [exp] 84 / 2e-22 AT2G18660 44 / 2e-06 plant natriuretic peptide A (.1) Lus10026929 [exp] 80 / 5e-21 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1) Lus10020126 [exp] 49 / 7e-09 AT2G18660 57 / 7e-11 plant natriuretic peptide A (.1) Lus10026930 [exp] 50 / 8e-09 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1) Lus10026931 [exp] 49 / 2e-08 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1) Lus10020130 [exp] 48 / 4e-08 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1) Lus10020125 [exp] 47 / 6e-08 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1) Lus10020127 [exp] 37 / 0.0003 AT2G18660 50 / 1e-08 plant natriuretic peptide A (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF03330 [flax] [poplar] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Lus10026928 pacid=23142862 polypeptide=Lus10026928 locus=Lus10026928.g ID=Lus10026928.BGIv1.0 annot-version=v1.0 ATGGAGGTGTCGGTTGTGGCACCAAAGTACACAATAACTTGCGTGGCGAGTTCGGACAGTAATGCATGCCTTTCATGGGCAAAACCTATCACGATCACTG TAGCTGATGACTGCAAACCGGAGCAGCCTCATTACGAGAAATGCCCTACTTTTGTTCTGTCGAAACAAGTTTACTCAGCCATTGCAAACACTGATGCTGG CGTACAGTAG
AA sequence Show only first row Show all	>Lus10026928 pacid=23142862 polypeptide=Lus10026928 locus=Lus10026928.g ID=Lus10026928.BGIv1.0 annot-version=v1.0 MEVSVVAPKYTITCVASSDSNACLSWAKPITITVADDCKPEQPHYEKCPTFVLSKQVYSAIANTDAGVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026928 [exp]	0	1
AT2G46150			Late embryogenesis abundant (L...		Lus10027177 [exp]	2.0	1.0000
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10018047 [exp]	2.6	0.9699
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10012854 [exp]	2.8	1.0000
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Lus10005762 [exp]	3.5	0.9854
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10013728 [exp]	3.5	1.0000
AT4G37330		CYP81D4	"cytochrome P450, family 81, s...		Lus10024817 [exp]	4.0	1.0000
AT2G37010		ATNAP12	non-intrinsic ABC protein 12 (...		Lus10023199 [exp]	4.0	0.9631
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10006360 [exp]	4.5	0.9881
					Lus10000861 [exp]	6.0	0.8840
AT5G42905			Polynucleotidyl transferase, r...		Lus10034950 [exp]	6.0	0.9406

Compare expression of checked genes

Lus10026928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.