Lus10026929 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 48 / 7e-08 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT5G39310 48 / 4e-07 ATHEXPALPHA1.19, ATEXP24, ATEXPA24 EXPANSIN 24, expansin A24 (.1)
AT2G03090 46 / 1e-06 ATHEXPALPHA1.3, ATEXP15, ATEXPA15 EXPANSIN 15, expansin A15 (.1)
AT4G30380 45 / 1e-06 EXLB2 Barwin-related endoglucanase (.1)
AT2G37640 45 / 3e-06 ATHEXPALPHA1.9, ATEXP3, ATEXPA3, EXP3 ARABIDOPSIS THALIANA EXPANSIN A3, EXPANSIN 3, Barwin-like endoglucanases superfamily protein (.1)
AT2G45110 44 / 8e-06 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT5G56320 44 / 9e-06 ATHEXPALPHA1.5, ATEXP14, ATEXPA14 EXPANSIN 14, expansin A14 (.1)
AT5G39280 43 / 1e-05 ATEXP23, ATHEXPALPHA1.17, ATEXPA23 EXPANSIN 23, expansin A23 (.1)
AT1G69530 43 / 1e-05 ATHEXPALPHA1.2, AT-EXP1, ATEXP1, ATEXPA1, EXP1 EXPANSIN 1, expansin A1 (.1.2.3.4.5)
AT5G39300 43 / 2e-05 ATHEXPALPHA1.18, ATEXP25, ATEXPA25 EXPANSIN 25, expansin A25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020129 177 / 2e-58 AT2G18660 44 / 2e-06 plant natriuretic peptide A (.1)
Lus10020128 125 / 7e-36 ND 48 / 6e-07
Lus10020125 92 / 1e-24 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1)
Lus10020126 86 / 4e-22 AT2G18660 57 / 7e-11 plant natriuretic peptide A (.1)
Lus10026928 80 / 1e-20 ND /
Lus10020130 72 / 1e-16 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 72 / 4e-16 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10020127 68 / 2e-15 AT2G18660 50 / 1e-08 plant natriuretic peptide A (.1)
Lus10031759 67 / 9e-15 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G218300 71 / 2e-16 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G098200 65 / 3e-14 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G176300 57 / 2e-11 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G179300 56 / 5e-11 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 56 / 8e-11 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.014G066300 47 / 7e-07 AT1G65680 322 / 2e-111 expansin B2 (.1)
Potri.001G001100 45 / 2e-06 AT2G03090 375 / 5e-133 EXPANSIN 15, expansin A15 (.1)
Potri.010G202500 45 / 2e-06 AT2G39700 473 / 2e-171 expansin A4 (.1)
Potri.006G249500 44 / 4e-06 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 44 / 5e-06 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10026929 pacid=23142925 polypeptide=Lus10026929 locus=Lus10026929.g ID=Lus10026929.BGIv1.0 annot-version=v1.0
ATGGCGAACAACTGTCTCCTGCTCGCAGTAGTGTTACTTGTTCTCTTCTCTATTTGGCGTTCCACATCTGCACTTTACTCTGGCACTGCTGCCTTTTCAG
AGTCTCCTTCTCCTCGTTCATGCTATGGGATTGACCCGCAAAACTACATGGTGGCTGCAGTAAGAGCCGACCTATATAACAATGGTGCAGGTTGCGGGGC
CAAGTACACAATAACTTGCGTGGGGAGTACGGACAATCCATGCCTACCGTCGGCGCAACCTATCACGGTCACCGTAGCTGATGACTGCACACCGGAGGCG
CCTGATTACGAGGAATGCCCTACTTTTGTGATGTCACAAGGTGTTTTCGCAAGAATTGCACCCCTTAATTCTGGCGTCGTCGAGGTTTCCTATCAGCTGT
AA
AA sequence
>Lus10026929 pacid=23142925 polypeptide=Lus10026929 locus=Lus10026929.g ID=Lus10026929.BGIv1.0 annot-version=v1.0
MANNCLLLAVVLLVLFSIWRSTSALYSGTAAFSESPSPRSCYGIDPQNYMVAAVRADLYNNGAGCGAKYTITCVGSTDNPCLPSAQPITVTVADDCTPEA
PDYEECPTFVMSQGVFARIAPLNSGVVEVSYQL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10026929 0 1
AT5G03620 Subtilisin-like serine endopep... Lus10003254 6.6 0.6853
AT1G62310 transcription factor jumonji (... Lus10004603 8.5 0.6538
AT5G12060 Plant self-incompatibility pro... Lus10023085 11.5 0.6534
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 12.8 0.6534
AT5G18460 Protein of Unknown Function (D... Lus10006861 14.1 0.6534
Lus10011218 15.0 0.6531
Lus10017803 15.1 0.6929
AT2G17030 F-box family protein with a do... Lus10022619 16.2 0.6455
AT2G39730 RCA rubisco activase (.1.2.3) Lus10035616 17.5 0.6431
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001037 22.1 0.6282

Lus10026929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.