Lus10026931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 49 / 3e-07 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 45 / 4e-06 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026930 85 / 1e-19 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10020130 81 / 2e-18 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10042435 62 / 7e-12 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026929 59 / 7e-11 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10026232 59 / 2e-10 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10031759 56 / 2e-09 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10019978 55 / 2e-09 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10042436 54 / 2e-09 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10020126 54 / 6e-09 AT2G18660 57 / 7e-11 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G218300 62 / 5e-12 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G176300 54 / 4e-09 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.018G098200 52 / 1e-08 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G179300 52 / 3e-08 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 50 / 8e-08 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G252200 40 / 0.0003 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G031901 40 / 0.0005 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 39 / 0.001 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10026931 pacid=23142910 polypeptide=Lus10026931 locus=Lus10026931.g ID=Lus10026931.BGIv1.0 annot-version=v1.0
ATGACTGCTGATTTACCCACTATATATAAAAGGCACCCTGGTGCCCAGAACAATCATCAAACCCTCAAATCAGTAGCTAATAATCACAAGAAGCTAGCTA
GCTTCATAGCTTCAAACACTGCATATGCAATGAAGTTCGAAAATCGTTCGGTCTGTTTGGCGTTGTTGGTGATATCAATGCTTTTGATAATCAATTTTGA
TCTACAGCTTCAGGGTGTAGCAGCAACTGGTAGGAAAGTTCCAACCCTTCCTGCCGAAAATGGAACCGCTGGCTTCTTCGACACTGCTCCCTCGAAGACG
GCGTGTGAGGGGCTAAACAAGAACCAAGGCGATCTGATTGGGTCGGCTGATATTAGAGTGTTCAAAAGAGGGGAGAGTTGCGGCAAGAAGTTTGAAGTAA
CTTGCATTGGCGGCGAGGACGCTACTAAGCCGAATCCGTGCAAGAAAGACAAGAAATCGGTAGTGATAAAGATAGTGGACACTTGCGAGCCAGATCCGAA
GAACCCATGCCCCACTTTGCTCCTTTCCCAGAAAGCTTTCTCTTCCATCGCTAATCCTGATGCTGGTCTTGCTTCCATTTCCTTCAAACCGTCAGTTTCC
TTTCTTCACTTCTTTCTATTTGCTTTTCCTGTTTTCTTGCTATTTTCCCGGCTTCTTTTAGGTGCAGAGTCCAAATTTGGAGTCAAGAGCAATGACTTAT
GGATCAGATTTAAAAAGTCCGTACAAATTTCAATCATCCAAAATTTATATTTTAGATCTAACAGCTGA
AA sequence
>Lus10026931 pacid=23142910 polypeptide=Lus10026931 locus=Lus10026931.g ID=Lus10026931.BGIv1.0 annot-version=v1.0
MTADLPTIYKRHPGAQNNHQTLKSVANNHKKLASFIASNTAYAMKFENRSVCLALLVISMLLIINFDLQLQGVAATGRKVPTLPAENGTAGFFDTAPSKT
ACEGLNKNQGDLIGSADIRVFKRGESCGKKFEVTCIGGEDATKPNPCKKDKKSVVIKIVDTCEPDPKNPCPTLLLSQKAFSSIANPDAGLASISFKPSVS
FLHFFLFAFPVFLLFSRLLLGAESKFGVKSNDLWIRFKKSVQISIIQNLYFRSNS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026931 0 1
Lus10018519 1.7 0.7052
AT5G63810 BGAL10 beta-galactosidase 10 (.1) Lus10023977 12.7 0.6831
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 15.1 0.6809
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 17.4 0.6809
AT2G31230 AP2_ERF ATERF15 ethylene-responsive element bi... Lus10022935 17.5 0.6283
AT3G58060 Cation efflux family protein (... Lus10016239 18.6 0.6445
Lus10000400 19.5 0.6809
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 21.4 0.6809
AT5G18460 Protein of Unknown Function (D... Lus10006860 23.1 0.6809
AT5G58840 Subtilase family protein (.1) Lus10016483 24.0 0.6156

Lus10026931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.