Lus10026932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 57 / 7e-11 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 50 / 4e-08 EXLB2 Barwin-related endoglucanase (.1)
AT2G45110 51 / 5e-08 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT1G65681 48 / 6e-07 EXPB6 beta expansin 6 (.1)
AT4G17030 46 / 3e-06 ATHEXPBETA3.1, ATEXPR1, AT-EXPR, ATEXLB1 expansin-like B1 (.1)
AT5G02260 42 / 0.0001 ATHEXPALPHA1.10, ATEXP9, ATEXPA9 expansin A9 (.1)
AT3G55500 39 / 0.0007 ATHEXPALPHA1.7, ATEXP16, ATEXPA16 EXPANSIN 16, expansin A16 (.1)
AT1G26770 39 / 0.0009 ATHEXPALPHA1.1, AT-EXP10, ATEXP10, ATEXPA10 ARABIDOPSIS THALIANA EXPANSIN ALPHA 1.1, ARABIDOPSIS THALIANA EXPANSIN 10, expansin A10 (.1.2)
AT1G20190 39 / 0.001 ATHEXPALPHA1.14, ATEXP11, ATEXPA11 EXPANSIN 11, expansin 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020131 241 / 2e-82 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1)
Lus10042436 102 / 1e-28 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10042435 60 / 2e-11 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026930 60 / 4e-11 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10026929 58 / 4e-11 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10020130 58 / 1e-10 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026232 58 / 1e-10 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10019978 57 / 1e-10 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026931 57 / 7e-10 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098200 74 / 2e-17 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.003G218300 68 / 1e-14 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G179300 66 / 4e-14 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 66 / 6e-14 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G176300 55 / 6e-10 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.018G029100 53 / 4e-09 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 50 / 2e-08 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.006G249500 45 / 3e-06 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 45 / 4e-06 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.008G088300 42 / 8e-05 AT1G69530 335 / 3e-117 EXPANSIN 1, expansin A1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10026932 pacid=23142827 polypeptide=Lus10026932 locus=Lus10026932.g ID=Lus10026932.BGIv1.0 annot-version=v1.0
ATGGCAGCTGCTACTACTACTGGTGGCCTCATCATCGTCAATTCCTGCTCTCTACCTCTTCTGGCTGCTTTCTTCGTCGCCATCTCCTTAAGCTTCACTT
CTCTTGCTTCTGCTGCTGGCAACGGAACTGCTTCCTCTTACCGCCCCGATGCTACATCGGCGTGCAAAAGCCACACCGGTTCAGCATCAATCGGCCAGAC
ACTGGTTGCGTTGATCGGTCAGACACTGGTTGCGATGGTTCCGAAGGCAGCGTTCAATAACGGAGCAGCGTGCGGGAGGATGTACAAGATTAGTTGCATC
GGAGCTATAGACGAATACCCAAAAGAACCCTGCAAACTCAATCAGTCGGTAACGGTGACGGTTGCGAATGAGTGCGGCGGGGACGATTGTGCAACTTTTA
CATTGTCCACTGACGCTTACGCTTTAATTTCCAAACCTGATGCTGGTCACATTCAGATCTCTTACAGACGGCTGGAAAACCGGTCTCGGTTAGAGGATCG
GTTTAACCGAGGTCGAGGGCGTTCGGAGAACGATTAA
AA sequence
>Lus10026932 pacid=23142827 polypeptide=Lus10026932 locus=Lus10026932.g ID=Lus10026932.BGIv1.0 annot-version=v1.0
MAAATTTGGLIIVNSCSLPLLAAFFVAISLSFTSLASAAGNGTASSYRPDATSACKSHTGSASIGQTLVALIGQTLVAMVPKAAFNNGAACGRMYKISCI
GAIDEYPKEPCKLNQSVTVTVANECGGDDCATFTLSTDAYALISKPDAGHIQISYRRLENRSRLEDRFNRGRGRSEND

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10026932 0 1
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Lus10037004 6.4 0.6787
AT1G04610 YUC3 YUCCA 3 (.1) Lus10032608 17.7 0.6333
AT2G42040 unknown protein Lus10021062 27.5 0.5782
AT4G05220 Late embryogenesis abundant (L... Lus10007636 28.5 0.6122
AT1G18530 EF hand calcium-binding protei... Lus10038953 42.2 0.5698
AT4G17260 Lactate/malate dehydrogenase f... Lus10006030 51.0 0.5722
AT5G02930 F-box/RNI-like superfamily pro... Lus10040452 54.1 0.5915
AT4G16566 HINT4 histidine triad nucleotide-bin... Lus10007467 69.2 0.5678
AT2G44760 Domain of unknown function (DU... Lus10020744 72.8 0.5670
AT5G16990 Zinc-binding dehydrogenase fam... Lus10007832 82.7 0.5673

Lus10026932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.