Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22470 133 / 2e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63080 132 / 2e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12775 128 / 1e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63400 127 / 1e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62590 127 / 1e-34 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G62930 127 / 1e-34 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12300 127 / 2e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63330 126 / 4e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12620 125 / 7e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 125 / 1e-33 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014242 [exp] 246 / 6e-81 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003433 [exp] 251 / 7e-81 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 242 / 8e-78 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009201 [exp] 234 / 1e-77 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 241 / 3e-77 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 239 / 1e-76 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 199 / 3e-61 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10039310 [exp] 190 / 5e-61 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10020134 [exp] 192 / 8e-61 AT1G12700 254 / 3e-78 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G032600 [exp] 157 / 2e-45 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 157 / 2e-45 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 155 / 7e-45 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050400 [exp] 155 / 8e-45 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034400 [exp] 155 / 2e-44 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G045000 [exp] 155 / 2e-44 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 154 / 4e-44 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G047400 [exp] 151 / 9e-44 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G046100 [exp] 150 / 9e-43 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034300 [exp] 147 / 9e-43 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10026935 pacid=23142867 polypeptide=Lus10026935 locus=Lus10026935.g ID=Lus10026935.BGIv1.0 annot-version=v1.0 ATGGGGAAGACAATCTTCTCCCATGGACACAGCTTTCAATTTCAGCTCTTAAGCAAAGCGAGTATGACTAAGTTTCCCTATTCTATGATGCAGAAAGGAC AGCATCCGGATATAGTCACTTACAATTCATTGCTAGATGGGTATTGTTTGCGTAATGAACTAGATAAAGCTAATGACTTGTTTGTTTCCTTAGTTAGCAT GGAATGCGAGCCTACCGTTTATACTTATAATATGATGATTAATGGATATTGTAAGAGTGAAAGGTTCAGTGAAGCCAAACAGTTATTGAATGATATGCTT GAAAAGGATTTAGTTCCAGACATTGTTACGTATAGTACTCTTGTGGATGGGTTTTGCCGAGCAGGGAGGTTCGAAGATGCAGAAAAAGTTCTAAAGGAAA TGTGCCATCAGGGACAGCTTCCGAATGTCGTGACATTCAGCAGTTTGCTAAATGGTTGGTGCAAAATAGATCATCTTGACAAGGCATTAGCCTATTCCAA GAAATCAAAAGTAGTCGGTTGA
AA sequence Show only first row Show all	>Lus10026935 pacid=23142867 polypeptide=Lus10026935 locus=Lus10026935.g ID=Lus10026935.BGIv1.0 annot-version=v1.0 MGKTIFSHGHSFQFQLLSKASMTKFPYSMMQKGQHPDIVTYNSLLDGYCLRNELDKANDLFVSLVSMECEPTVYTYNMMINGYCKSERFSEAKQLLNDML EKDLVPDIVTYSTLVDGFCRAGRFEDAEKVLKEMCHQGQLPNVVTFSSLLNGWCKIDHLDKALAYSKKSKVVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10026935 [exp]	0	1
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	5.1	0.7259
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Lus10022646 [exp]	6.5	0.7209
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	8.8	0.7167
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	10.2	0.7167
					Lus10033096 [exp]	11.4	0.7167
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	12.5	0.7167
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	13.5	0.6974
AT3G44150			unknown protein		Lus10021005 [exp]	14.7	0.6965
AT5G36930			Disease resistance protein (TI...		Lus10014303 [exp]	14.8	0.6928
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	15.6	0.6955

Compare expression of checked genes

Lus10026935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.