Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24860 174 / 6e-58 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) AT5G10625 171 / 2e-56 unknown protein AT4G31380 154 / 6e-49 FLP1 FPF1-like protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020156 [exp] 238 / 9e-83 AT5G24860 180 / 4e-60 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10000506 [exp] 145 / 3e-46 AT5G24860 142 / 2e-45 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10037510 [exp] 141 / 7e-45 AT5G24860 139 / 4e-44 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10040802 [exp] 89 / 1e-23 AT4G31380 95 / 2e-25 FPF1-like protein 1 (.1) Lus10016534 [exp] 37 / 0.0002 ND 37 / 2e-07
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G005200 [exp] 180 / 4e-60 AT5G10625 165 / 2e-54 unknown protein Potri.006G276100 [exp] 180 / 4e-60 AT5G10625 167 / 5e-55 unknown protein Potri.008G209300 [exp] 151 / 1e-48 AT5G24860 140 / 1e-44 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Potri.010G024500 [exp] 150 / 3e-48 AT5G24860 139 / 4e-44 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Potri.009G031600 [exp] 114 / 1e-33 AT5G24860 114 / 6e-34 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026956 pacid=23142858 polypeptide=Lus10026956 locus=Lus10026956.g ID=Lus10026956.BGIv1.0 annot-version=v1.0 ATGTCAGGGGTGTGGGTGTTCAAGAACGGGCTGATACGCCTAGTCGAAAACCCGGGTCATGCCGATCATAATCAAATGGGTGGTGGTCAGGCGACTAGCA CCAGAAGGAAGGCGTTGGTACACTTGACCACCGGAGAAGTGATTTCGTCCTATTCGTCGCTCGAGCATATACTGAGGGAATTGGGCTGGGAGAGGTACTA CGGTGGGGACCCTGACCTTCTTCAGTTCCACAAGAGATCCTCCATCGACTTGATATCGCTCCCGCGTGACTTCAACAAGTTCAACTCCGTCTACATGTAC GACATCGTGGTCAAGAACCCTAACATCTTCCACGTCCGTGACATTCACTACTAA
AA sequence Show only first row Show all	>Lus10026956 pacid=23142858 polypeptide=Lus10026956 locus=Lus10026956.g ID=Lus10026956.BGIv1.0 annot-version=v1.0 MSGVWVFKNGLIRLVENPGHADHNQMGGGQATSTRRKALVHLTTGEVISSYSSLEHILRELGWERYYGGDPDLLQFHKRSSIDLISLPRDFNKFNSVYMY DIVVKNPNIFHVRDIHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10026956 [exp]	0	1
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10001887 [exp]	3.9	0.8896
AT1G34060			Pyridoxal phosphate (PLP)-depe...		Lus10028695 [exp]	4.1	0.9011
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10000231 [exp]	7.7	0.8852
AT5G45650			subtilase family protein (.1)		Lus10002780 [exp]	8.5	0.8906
					Lus10002304 [exp]	9.2	0.8795
AT5G13240			transcription regulators (.1)		Lus10034638 [exp]	20.6	0.8857
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	22.5	0.8856
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	28.8	0.8740
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10012866 [exp]	29.9	0.7867
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	30.6	0.8740

Compare expression of checked genes

Lus10026956 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.