Lus10026969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026969 pacid=23142919 polypeptide=Lus10026969 locus=Lus10026969.g ID=Lus10026969.BGIv1.0 annot-version=v1.0
ATGCAGCAACAGAATTCAAGAATACCTTATAATCAAGAACTCACGAAAGCAGGAAATTTCTGGATTTCGATCAAAGCTGCTCGCTCACCTGGAGAATCTC
TGGGTGAGTTCGTGCAACCAAGACGCGCTTCGAACGAATCTCCGGGTGACGTCGATCAAGCAGTCACCAACAACTCTTGGAATCCAAAACCAGATTTCCT
ACTAATCTCACAGTTCCCCGGCGGTGAGTTGAAGTCTCAAATTTGTGCGATGAAATCCTTAACTGGTATCCGTAGATCACGGACTTTGGGAATTCCGTCG
AGGAAAAGAGGGTACGACGTAACGCTGACTGTGAGGTATGAATTCAGCTGCGGGAGAGGACTATGCCGGTGGAGTTGA
AA sequence
>Lus10026969 pacid=23142919 polypeptide=Lus10026969 locus=Lus10026969.g ID=Lus10026969.BGIv1.0 annot-version=v1.0
MQQQNSRIPYNQELTKAGNFWISIKAARSPGESLGEFVQPRRASNESPGDVDQAVTNNSWNPKPDFLLISQFPGGELKSQICAMKSLTGIRRSRTLGIPS
RKRGYDVTLTVRYEFSCGRGLCRWS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026969 0 1
AT3G04690 ANX1 ANXUR1, Malectin/receptor-like... Lus10016907 2.8 0.7837
AT1G03390 HXXXD-type acyl-transferase fa... Lus10033079 8.1 0.7857
AT5G26250 Major facilitator superfamily ... Lus10041212 9.8 0.7927
AT5G48385 FRIGIDA-like protein (.1) Lus10038038 11.7 0.7377
AT3G07320 O-Glycosyl hydrolases family 1... Lus10038211 12.4 0.7655
AT1G71690 Protein of unknown function (D... Lus10003512 14.8 0.7842
Lus10009357 15.4 0.7576
AT2G34930 disease resistance family prot... Lus10000236 17.0 0.7490
AT4G27890 HSP20-like chaperones superfam... Lus10027048 17.4 0.7753
AT2G22560 Kinase interacting (KIP1-like)... Lus10012730 17.6 0.7656

Lus10026969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.