Lus10026977 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24400 161 / 1e-50 SAUR-like auxin-responsive protein family (.1)
AT4G31320 152 / 5e-47 SAUR-like auxin-responsive protein family (.1)
AT5G20810 88 / 3e-22 SAUR-like auxin-responsive protein family (.1.2)
AT3G43120 86 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT4G34750 80 / 3e-19 SAUR-like auxin-responsive protein family (.1.2)
AT4G00880 75 / 1e-17 SAUR-like auxin-responsive protein family (.1)
AT3G61900 75 / 1e-17 SAUR-like auxin-responsive protein family (.1)
AT2G21220 73 / 3e-17 SAUR-like auxin-responsive protein family (.1)
AT2G46690 74 / 4e-17 SAUR-like auxin-responsive protein family (.1)
AT1G56150 72 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035716 120 / 3e-34 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1)
Lus10033348 113 / 1e-31 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10037302 108 / 7e-29 AT2G24400 150 / 2e-44 SAUR-like auxin-responsive protein family (.1)
Lus10034888 85 / 6e-21 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Lus10012426 78 / 2e-18 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10026297 78 / 3e-18 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10042374 74 / 5e-17 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10010110 72 / 1e-16 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034507 72 / 4e-16 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G278100 171 / 8e-55 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 143 / 2e-43 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 130 / 6e-39 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 89 / 2e-22 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.004G164300 88 / 2e-22 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 89 / 4e-22 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.009G125900 82 / 3e-20 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 81 / 2e-19 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 79 / 7e-19 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 78 / 2e-18 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10026977 pacid=23142964 polypeptide=Lus10026977 locus=Lus10026977.g ID=Lus10026977.BGIv1.0 annot-version=v1.0
ATGGATTGCAAGAAGTCTAACAAGATTACCGAAATCGTTAGGCTTCAGCAGATCCTGAAGAAATGGCGAAAGCTAGCCAACTCATCCAAAACCTCACCTT
CCTCCTCCATACCTGCAAATAACAGCTACAACTACAGCGGCAGCAAAAGCATCAAGTTCCTGAAGAGAACTCTGTCATTATCAGAGAGCAGTGGCGATGG
TGGTTCCTCCACCAGCATCCCAGTTCCCAAGGGGTTCCTGGCTGTGAGCGTTGGAGAGGAACAGAAGAGATTCACAATCCCAACAGAGTATCTCAGCCAC
CCTGCATTCCACATTTTGCTAAGAGAGGCAGAAGAGGAGTTTGGGTTCCAGCAGGCTGGAGTGCTGAGAATCCCCTGTGGAGTTGCTGTTTTCGAGAGCG
TGCTGAGGATAGTGGAAGACAAGAAAGATGACTACTTCATGTTCAACGTTGAAGATGGTGTTGCTGGAGGATATGGTTACTGTTCATTGACTGGCCAGCA
TACTCCAACTCACCACCACCCTCAAAGCCCTATGTGCAGATGA
AA sequence
>Lus10026977 pacid=23142964 polypeptide=Lus10026977 locus=Lus10026977.g ID=Lus10026977.BGIv1.0 annot-version=v1.0
MDCKKSNKITEIVRLQQILKKWRKLANSSKTSPSSSIPANNSYNYSGSKSIKFLKRTLSLSESSGDGGSSTSIPVPKGFLAVSVGEEQKRFTIPTEYLSH
PAFHILLREAEEEFGFQQAGVLRIPCGVAVFESVLRIVEDKKDDYFMFNVEDGVAGGYGYCSLTGQHTPTHHHPQSPMCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G24400 SAUR-like auxin-responsive pro... Lus10026977 0 1
AT2G17080 Arabidopsis protein of unknown... Lus10023962 2.4 0.8117
AT3G52440 DOF AtDof3,5 Dof-type zinc finger DNA-bindi... Lus10029767 3.7 0.8085
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007588 4.0 0.8002
AT1G67400 ELMO/CED-12 family protein (.1... Lus10037017 7.1 0.8022
AT3G58310 Domain of unknown function (DU... Lus10042124 8.7 0.7222
AT4G23740 Leucine-rich repeat protein ki... Lus10014943 9.0 0.7629
AT2G45320 unknown protein Lus10030280 13.8 0.7687
AT5G04420 Galactose oxidase/kelch repeat... Lus10037933 16.2 0.6862
Lus10025086 20.0 0.7678
AT1G67590 Remorin family protein (.1.2) Lus10036996 21.2 0.7606

Lus10026977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.