Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24395 116 / 2e-34 chaperone protein dnaJ-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020173 [exp] 148 / 5e-47 AT2G24395 89 / 2e-23 chaperone protein dnaJ-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G278250 [exp] 128 / 2e-39 AT2G24395 116 / 2e-34 chaperone protein dnaJ-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026979 pacid=23142810 polypeptide=Lus10026979 locus=Lus10026979.g ID=Lus10026979.BGIv1.0 annot-version=v1.0 ATGTTCACAGTAGCTCCGGCGAACCTAAATTGCCTGAGTCAGAAGATTCTTCCGTCGTCTTCTCCAAGTAGAGGCTGGAAGAATCATTATGTATTGAAAC CTCTGAATTGCTCTTCTTCTGCTTCTTCTTCCTCCACTTCCGTCCAGCAAGTTCAAGAACAACAACAGGTTGACTCAGAAGGGATTATGTGTGAACCTTG CAATGGGAAAGGATGGTTAGTTTGCGATTTCTGCAACGGACAGAAAACCAACGTCAAGGCCGAAAACAAACGGATGTACCGCAGGTGTCCATCTTGTAGA GCTGTTGGATACATGTTGTGTTCAAGGTGCAAAGTGTTCAAATGTGTTGCCTTCCCAAATTATAGTGATGGGGAGGAGCTATCCTTTTAA
AA sequence Show only first row Show all	>Lus10026979 pacid=23142810 polypeptide=Lus10026979 locus=Lus10026979.g ID=Lus10026979.BGIv1.0 annot-version=v1.0 MFTVAPANLNCLSQKILPSSSPSRGWKNHYVLKPLNCSSSASSSSTSVQQVQEQQQVDSEGIMCEPCNGKGWLVCDFCNGQKTNVKAENKRMYRRCPSCR AVGYMLCSRCKVFKCVAFPNYSDGEELSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24395			chaperone protein dnaJ-related...		Lus10026979 [exp]	0	1
AT5G44650		Y3IP1, AtCEST	Ycf3-interacting protein 1, Ar...		Lus10024729 [exp]	2.4	0.8890
AT3G04650			FAD/NAD(P)-binding oxidoreduct...		Lus10022002 [exp]	4.0	0.8531
AT3G10840			alpha/beta-Hydrolases superfam...		Lus10003690 [exp]	4.9	0.8552
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10015113 [exp]	5.7	0.8556
AT2G24395			chaperone protein dnaJ-related...		Lus10020173 [exp]	8.4	0.8503
AT5G52110		CCB2, HCF208	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10027422 [exp]	8.9	0.8125
AT4G29670		ACHT2	atypical CYS HIS rich thiored...		Lus10007994 [exp]	9.2	0.8425
AT1G68190	CO		B-box zinc finger family prote...		Lus10034625 [exp]	10.2	0.7625
AT3G08800		SIEL	SHORT-ROOT interacting embryon...		Lus10000343 [exp]	10.2	0.7816
					Lus10006129 [exp]	14.7	0.8443

Compare expression of checked genes

Lus10026979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.