Lus10026984 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31300 334 / 2e-115 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT2G24390 150 / 2e-44 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
AT4G31310 148 / 1e-43 AIG2-like (avirulence induced gene) family protein (.1)
AT3G28930 120 / 9e-33 AIG2 AVRRPT2-INDUCED GENE 2, AIG2-like (avirulence induced gene) family protein (.1)
AT3G28940 118 / 5e-32 AIG2-like (avirulence induced gene) family protein (.1)
AT5G39730 114 / 2e-30 AIG2-like (avirulence induced gene) family protein (.1)
AT5G39720 104 / 9e-27 AIG2L avirulence induced gene 2 like protein (.1)
AT3G28950 103 / 1e-26 AIG2-like (avirulence induced gene) family protein (.1)
AT5G40580 102 / 8e-25 PBB2 20S proteasome beta subunit PBB2 (.1.2.3)
AT3G27430 100 / 3e-24 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020180 370 / 2e-129 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020179 208 / 2e-67 AT4G31310 115 / 2e-33 AIG2-like (avirulence induced gene) family protein (.1)
Lus10014581 105 / 9e-26 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3)
Lus10032102 103 / 3e-25 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10006426 76 / 2e-15 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10011369 75 / 5e-15 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10041194 59 / 4e-10 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1)
Lus10039351 57 / 2e-09 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1)
Lus10042145 47 / 7e-06 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145900 333 / 4e-115 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.006G077900 333 / 4e-115 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.006G278900 183 / 5e-57 AT2G24390 194 / 4e-64 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
Potri.018G003000 181 / 2e-56 AT2G24390 191 / 8e-63 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
Potri.017G071100 100 / 3e-24 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3)
Potri.004G066000 99 / 2e-23 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.008G177000 76 / 1e-15 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.010G058100 76 / 3e-15 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.016G015400 50 / 7e-07 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1)
Potri.006G008800 47 / 7e-06 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
CL0278 AIG2 PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like
Representative CDS sequence
>Lus10026984 pacid=23142878 polypeptide=Lus10026984 locus=Lus10026984.g ID=Lus10026984.BGIv1.0 annot-version=v1.0
ATGGATACGTGTATCAGCGATCTGAATGCTCCCCACTCGATGGGCACCACCATCATCGGCGTCACCTATAACGGCGGCGTTATTCTCGGCGCAGATTCCC
GGACCAGCACCGGAATGTATGTTGCTAACAGGGCTTCGGACAAGATTACCCAGCTCACTGATAACGTCTACGTCTGTCGCTCTGGATCGGCTGCAGATTC
CCAGATTGTTTCTGACTATGTCCGATACTTTTTGCATCAACACACAATACAATTAGGACAGCCTTCAACTGTCAAGGTTGCTGCAAACCTTGTCCGCCTA
TTGTCATACAATAACAAGAACAATCTACAAACTGGTCTCATCATTGGTGGATGGGACAAGTATGAAGGTGGGAAAATTTATGGAGTCCCTCTTGGTGGAA
CGTTGGTAGAGGCACCCTTTGCTATTGGAGGATCTGGTTCCAGTTACTTGTATGGGTTCTTTGATCAAGTTTGGAAAGATGGCATGACTAAAGAGGAAGC
AGAGCAATTAGTGGTGAAGGCAGTTTCCCTAGCCATTGCAAGAGATGGTGCAAGTGGCGGTGTTGTCCGCACTGTGGTTGTGTTCGTGCGACTCTCTTAC
ACCCAATTACACTTAGCCATTGGTGAGGCCAAGCTCCAGGAGATTGACGAGATTCATAGGTTCAGCATAAAAGGGAGGGTTTATCCTGCCATTCTACCCA
TTGATAACAAGAGGATTCAGGGCAAAGTCCTGTTTGGGATTACCGATCCTGAACTACTGGTTCTCGATATCTTCGAGGATGTTGAGTATGAGCGTCGCAC
TGTCCAAGTTTCCCTCCCGGAGGAGGAGAAGAAGCTAGAAGTGTATGCCTATGTTTGGGGAAACAAGGACGATCCTGACTTGTGTGGAGAATGGGATTTT
GAGGAGTGGAAGAAAGCACACATGAGTGATTTTGTGAAGATGACAGCAGAATTCATGGAAGAATTACAGCAACCAGATTCAAAGACGAGAGTGGCGACCT
ACGAATCTTACTATAACACAACACTAGTTACCACCGATAGTGCTTCTACCGAGCCTTGA
AA sequence
>Lus10026984 pacid=23142878 polypeptide=Lus10026984 locus=Lus10026984.g ID=Lus10026984.BGIv1.0 annot-version=v1.0
MDTCISDLNAPHSMGTTIIGVTYNGGVILGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPSTVKVAANLVRL
LSYNNKNNLQTGLIIGGWDKYEGGKIYGVPLGGTLVEAPFAIGGSGSSYLYGFFDQVWKDGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVVVFVRLSY
TQLHLAIGEAKLQEIDEIHRFSIKGRVYPAILPIDNKRIQGKVLFGITDPELLVLDIFEDVEYERRTVQVSLPEEEKKLEVYAYVWGNKDDPDLCGEWDF
EEWKKAHMSDFVKMTAEFMEELQQPDSKTRVATYESYYNTTLVTTDSASTEP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G31300 PBA1 N-terminal nucleophile aminohy... Lus10026984 0 1
AT1G45000 AAA-type ATPase family protein... Lus10017972 1.0 0.7971
AT3G18940 clast3-related (.1) Lus10021018 2.8 0.6740
AT1G53750 RPT1A regulatory particle triple-A 1... Lus10031243 4.5 0.6869
AT3G02540 RAD23C, RAD23-3 RADIATION SENSITIVE23C, PUTATI... Lus10034308 4.9 0.6596
AT3G07640 unknown protein Lus10036423 8.3 0.6775
AT1G66680 AR401 S-adenosyl-L-methionine-depend... Lus10017619 11.2 0.6231
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Lus10003292 12.4 0.6342
AT2G32980 unknown protein Lus10035310 17.9 0.6238
AT4G24820 26S proteasome, regulatory sub... Lus10014789 19.3 0.6641
AT4G31890 ARM repeat superfamily protein... Lus10013459 22.2 0.6237

Lus10026984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.