Lus10026987 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35390 163 / 8e-47 Leucine-rich repeat protein kinase family protein (.1)
AT1G72460 139 / 2e-38 Leucine-rich repeat protein kinase family protein (.1)
AT2G07040 136 / 3e-37 ATPRK2A Leucine-rich repeat protein kinase family protein (.1)
AT4G31250 132 / 1e-35 Leucine-rich repeat protein kinase family protein (.1)
AT3G20190 127 / 4e-34 Leucine-rich repeat protein kinase family protein (.1)
AT1G50610 124 / 1e-32 Leucine-rich repeat protein kinase family protein (.1)
AT3G42880 110 / 5e-28 Leucine-rich repeat protein kinase family protein (.1)
AT5G20690 104 / 7e-26 Leucine-rich repeat protein kinase family protein (.1)
AT3G02880 103 / 1e-25 Leucine-rich repeat protein kinase family protein (.1)
AT1G48480 95 / 2e-22 RKL1 receptor-like kinase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026988 286 / 1e-93 AT4G31250 606 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10020183 271 / 1e-87 AT4G31250 599 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10027597 148 / 3e-41 AT5G35390 603 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10033339 147 / 3e-41 AT3G20190 600 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10022946 142 / 5e-39 AT5G35390 593 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10005175 137 / 7e-38 AT5G20690 417 / 1e-138 Leucine-rich repeat protein kinase family protein (.1)
Lus10017144 137 / 2e-37 AT5G35390 597 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10027645 122 / 4e-34 AT1G72460 211 / 8e-64 Leucine-rich repeat protein kinase family protein (.1)
Lus10037687 110 / 2e-29 AT1G72460 212 / 4e-64 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G002700 167 / 2e-48 AT3G20190 415 / 1e-136 Leucine-rich repeat protein kinase family protein (.1)
Potri.007G002000 160 / 6e-46 AT3G20190 437 / 4e-145 Leucine-rich repeat protein kinase family protein (.1)
Potri.018G002600 159 / 1e-45 AT3G20190 540 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.006G279300 149 / 5e-42 AT4G31250 570 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.018G147300 149 / 1e-41 AT5G35390 629 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.006G078600 147 / 6e-41 AT5G35390 660 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.001G166300 129 / 2e-34 AT3G42880 513 / 6e-174 Leucine-rich repeat protein kinase family protein (.1)
Potri.003G068800 121 / 8e-32 AT3G42880 471 / 6e-159 Leucine-rich repeat protein kinase family protein (.1)
Potri.017G130600 97 / 2e-23 AT5G16590 649 / 0.0 Leucine rich repeat protein 1, Leucine-rich repeat protein kinase family protein (.1)
Potri.006G139700 96 / 6e-23 AT3G42880 611 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
CL0022 PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Lus10026987 pacid=23142814 polypeptide=Lus10026987 locus=Lus10026987.g ID=Lus10026987.BGIv1.0 annot-version=v1.0
ATGATCATTCCCTCCATCTTCCTCCTCATCTTCATATCCTCCTCCTCATCATCCGCCCACCAAATCGAGGTAGAAGCACTCCTCAACTTCAAAAAATCAC
TCTCCAACGCATCCGCCACTCTACAGAGCTGGAACGCCACTCTCTCCCCACCTTGCAACCGTGACGACTTCGTCTGGACGGGCCTCCAGTGCGACAGAGG
ATCCGTCGAGAAGCTGATCCTCGATGGAATCGGACTCTCTGGGATCATCGACGTTGACTCCCTAGCCAACCTTCCCAGCCTCAGGACGTTCAGCATCATG
GCCAATAACTTCGACGGTCCCATTCCGGATTTTACTAAGCTTCCCTTGAAGAATCTCTACCTTTCCGGGAACCGATTCTCCGGCAGTATTCCGGACGATG
CTTTCCGAGGGATGAATTCGCTCAACGAGATTTACCTTGCCAATAACCGGTTCGTGGGGCCGATTCCCGAGTCGATTCTCGGATTGAAGAAACTGACCGA
GTTGAGCTTGGAAAGGAATCAGTTCACCGGTTCTATACCGGATTTTCAGCAGCAGTTTACTGTCATTAACGTCTCCGGGAATCAGTTGGTGGGTCCCGTT
CCGGAAAGCCTTTAG
AA sequence
>Lus10026987 pacid=23142814 polypeptide=Lus10026987 locus=Lus10026987.g ID=Lus10026987.BGIv1.0 annot-version=v1.0
MIIPSIFLLIFISSSSSSAHQIEVEALLNFKKSLSNASATLQSWNATLSPPCNRDDFVWTGLQCDRGSVEKLILDGIGLSGIIDVDSLANLPSLRTFSIM
ANNFDGPIPDFTKLPLKNLYLSGNRFSGSIPDDAFRGMNSLNEIYLANNRFVGPIPESILGLKKLTELSLERNQFTGSIPDFQQQFTVINVSGNQLVGPV
PESL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35390 Leucine-rich repeat protein ki... Lus10026987 0 1

Lus10026987 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.