Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02730 209 / 1e-69 TRXF1, ATF1 thioredoxin F-type 1 (.1) AT5G16400 201 / 2e-66 TRXF2, ATF2 thioredoxin F2 (.1) AT3G51030 72 / 1e-16 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G45145 69 / 2e-15 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G42980 69 / 3e-15 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 68 / 6e-15 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G39950 66 / 3e-14 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT4G26160 67 / 8e-14 ACHT1 atypical CYS HIS rich thioredoxin 1 (.1) AT1G59730 63 / 5e-13 ATH7 thioredoxin H-type 7 (.1) AT1G43560 61 / 7e-12 ATY2 thioredoxin Y2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020199 [exp] 337 / 4e-120 AT3G02730 207 / 6e-69 thioredoxin F-type 1 (.1) Lus10024293 [exp] 73 / 7e-17 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 71 / 6e-16 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 71 / 9e-16 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10005258 [exp] 70 / 2e-15 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10030666 [exp] 69 / 3e-15 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10014277 [exp] 69 / 4e-15 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 67 / 1e-14 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10022727 [exp] 67 / 2e-14 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G054800 [exp] 210 / 1e-69 AT3G02730 204 / 1e-67 thioredoxin F-type 1 (.1) Potri.007G018000 [exp] 79 / 5e-19 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 72 / 2e-16 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 70 / 7e-16 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.017G076700 [exp] 67 / 2e-14 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.008G194100 [exp] 66 / 7e-14 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.015G036000 [exp] 65 / 1e-12 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.006G110100 [exp] 61 / 4e-12 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.002G066800 [exp] 61 / 1e-11 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.018G066500 [exp] 61 / 1e-11 AT4G29670 253 / 3e-85 atypical CYS HIS rich thioredoxin 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10026999 pacid=23142836 polypeptide=Lus10026999 locus=Lus10026999.g ID=Lus10026999.BGIv1.0 annot-version=v1.0 ATGGCTCTTATCCATTTATCAACTTGTTCCTCCACCTCCGCCATCCATTCCTCTCCCAATTCCTTCCCCAGCTGCTCTCCGGTCCTCTCCTCCGTCAACA AGGATCACTCCGTCTCTTTCTCTGGATTCCCTACTTCCTCCGCCGGATGCAGCTTTTCCAAGAGGAGGAGCAGGAGGAAAGATTGTATTCTGACGGTCAA GTCAAGCATGGAGACTGTGGCCACCGTCGGACAGGTCACGGAAGTTTCTAATGACACTTTCTGGCCTATTGTTAAATCTGCCGGAGACAAAACGGTAGTC CTCGACATGTACACTCAGTGGTGTGGCCCTTGCAAGGTTATGGCTCCAAAGTACGAGGAGTTGTCTAAGAAATACCTGGACGTTGTTTTCTTGAAGCTGG ACTGCAACACTGAAAACAGGCCATTGGCGAAGGAGCTTGGCATTAGAGTGGTGCCAACTTTCAAGATTCTCAAGGATAACAAGATTGTAAAAGAAGTCAC GGGGGCGAAATTTGACGATCTTGTTCTAGCAATTGACACTGTCAGATCATCCAGCTGA
AA sequence Show only first row Show all	>Lus10026999 pacid=23142836 polypeptide=Lus10026999 locus=Lus10026999.g ID=Lus10026999.BGIv1.0 annot-version=v1.0 MALIHLSTCSSTSAIHSSPNSFPSCSPVLSSVNKDHSVSFSGFPTSSAGCSFSKRRSRRKDCILTVKSSMETVATVGQVTEVSNDTFWPIVKSAGDKTVV LDMYTQWCGPCKVMAPKYEELSKKYLDVVFLKLDCNTENRPLAKELGIRVVPTFKILKDNKIVKEVTGAKFDDLVLAIDTVRSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02730		TRXF1, ATF1	thioredoxin F-type 1 (.1)		Lus10026999 [exp]	0	1
AT1G18060			unknown protein		Lus10017999 [exp]	1.0	0.9751
AT4G25910		ATCNFU3, NFU3	NFU domain protein 3 (.1)		Lus10001634 [exp]	3.5	0.9426
AT3G54890		LHCA1	photosystem I light harvesting...		Lus10023509 [exp]	4.9	0.9374
AT4G37200		HCF164	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10022477 [exp]	5.3	0.9362
AT1G74470			Pyridine nucleotide-disulphide...		Lus10001642 [exp]	6.0	0.9370
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10041656 [exp]	7.3	0.9058
AT1G71500			Rieske (2Fe-2S) domain-contain...		Lus10009471 [exp]	7.5	0.9410
AT3G54890		LHCA1	photosystem I light harvesting...		Lus10040391 [exp]	8.5	0.9289
AT5G11840			Protein of unknown function (D...		Lus10027492 [exp]	9.4	0.9204
AT4G25910		ATCNFU3, NFU3	NFU domain protein 3 (.1)		Lus10001439 [exp]	10.4	0.9242

Compare expression of checked genes

Lus10026999 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.