Lus10027003 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026703 341 / 5e-121 ND /
Lus10041636 114 / 8e-32 ND /
Lus10024084 112 / 5e-31 ND /
Lus10005397 105 / 2e-28 ND /
Lus10005395 105 / 2e-28 ND /
Lus10024931 97 / 5e-25 ND /
Lus10022894 97 / 6e-25 ND /
Lus10005398 95 / 1e-24 ND /
Lus10022893 91 / 1e-22 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027003 pacid=23151553 polypeptide=Lus10027003 locus=Lus10027003.g ID=Lus10027003.BGIv1.0 annot-version=v1.0
ATGTCGTCCGCGGAGACGGTACTTGGATTGCCCAGGTACATGCTACTCGAAACCAAATACAGGGACCAGCAAACCGGATTCGACGAGTACAAACTCCTTC
ACTACCTCTGGAACGATGAGTTCGCCCCCTACTACAAAGGGTTCGGTAGCGTTAGAGATTTGGACCCTGCAAGCAGCCCGTTCGTAATGCTGGAGGTTGT
CCCTTCCACAAGTCGCCCAACGACCCACGTCCACCTCCGTTGCTCCTACAATAACAAGTACCTGCGTCTCGAACTGCACCCCACCATCGCCGGACTCAAC
TACCTCGTTGCCACTGCCAATGCTCCCAACGAGAGCAACACGGGGTCCAACGAATCCACACTCTTCAGTCCCCGCAGGTTCCCCGGGAACATCGTCTCTT
TCGAGCACAACTCCGGACGTTGGTTGCAAGCACCCACATTTACCGCGGCCTATGTGTATGCGAATGAGGGCGACAGTGGGGTTTTCTTCAAGTATTCGCG
ATGA
AA sequence
>Lus10027003 pacid=23151553 polypeptide=Lus10027003 locus=Lus10027003.g ID=Lus10027003.BGIv1.0 annot-version=v1.0
MSSAETVLGLPRYMLLETKYRDQQTGFDEYKLLHYLWNDEFAPYYKGFGSVRDLDPASSPFVMLEVVPSTSRPTTHVHLRCSYNNKYLRLELHPTIAGLN
YLVATANAPNESNTGSNESTLFSPRRFPGNIVSFEHNSGRWLQAPTFTAAYVYANEGDSGVFFKYSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027003 0 1
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10040732 1.4 0.9011
Lus10026703 1.4 0.8762
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10031114 3.0 0.8715
AT1G65620 AS2 AS2 ASYMMETRIC LEAVES 2, Lateral o... Lus10013610 4.2 0.8075
Lus10000901 5.7 0.7841
AT2G30340 AS2 LBD13 LOB domain-containing protein ... Lus10029061 10.0 0.7763
AT2G45220 Plant invertase/pectin methyle... Lus10006103 11.7 0.7825
AT1G26930 Galactose oxidase/kelch repeat... Lus10023608 11.7 0.7731
AT3G26040 HXXXD-type acyl-transferase fa... Lus10025522 20.4 0.7237
AT1G04610 YUC3 YUCCA 3 (.1) Lus10043142 21.2 0.8496

Lus10027003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.