Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032865 [exp] 68 / 1e-16 AT2G01050 40 / 9e-05 zinc ion binding;nucleic acid binding (.1) Lus10042500 [exp] 49 / 7e-09 ND / Lus10037474 [exp] 41 / 6e-06 ND / Lus10036275 [exp] 40 / 2e-05 ND / Lus10009076 [exp] 35 / 0.0008 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027005 pacid=23151516 polypeptide=Lus10027005 locus=Lus10027005.g ID=Lus10027005.BGIv1.0 annot-version=v1.0 ATGAAAAATCGAATGGCGGAGATTTGGCGTCCAAAATGTTGTGTGGTTGTTCGCAATCTCGAAGACAAACGTTTTTTATTCAAGTTTTACCACCGTCTCG ATTTGCAATGGGTTGTCAACAGTGGGTCGTGGAATCACAATGGGTGGGACAAACCAAAGGAGGTACCCCTCACTAATGCTGATTTCAGATTACAGGTTTA TGATCTTCAACTTACAGATTTTTAA
AA sequence Show only first row Show all	>Lus10027005 pacid=23151516 polypeptide=Lus10027005 locus=Lus10027005.g ID=Lus10027005.BGIv1.0 annot-version=v1.0 MKNRMAEIWRPKCCVVVRNLEDKRFLFKFYHRLDLQWVVNSGSWNHNGWDKPKEVPLTNADFRLQVYDLQLTDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027005 [exp]	0	1
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	3.6	0.9644
					Lus10036765 [exp]	5.1	0.9644
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10020643 [exp]	5.5	0.8878
AT2G16190			unknown protein		Lus10011284 [exp]	6.2	0.9644
AT2G14560		LURP1	LATE UPREGULATED IN RESPONSE T...		Lus10009095 [exp]	6.3	0.8650
AT3G54200			Late embryogenesis abundant (L...		Lus10031554 [exp]	7.2	0.9644
					Lus10006395 [exp]	8.1	0.9644
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	9.2	0.9529
					Lus10038080 [exp]	10.4	0.9396
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Lus10023568 [exp]	10.6	0.9417

Compare expression of checked genes

Lus10027005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.