Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025489 [exp] 44 / 4e-07 ND 53 / 2e-13 Lus10009488 [exp] 45 / 6e-07 AT1G33980 167 / 5e-47 Smg-4/UPF3 family protein (.1.2) Lus10003510 [exp] 42 / 1e-05 AT1G33980 200 / 9e-61 Smg-4/UPF3 family protein (.1.2) Lus10008346 [exp] 40 / 4e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027007 pacid=23151603 polypeptide=Lus10027007 locus=Lus10027007.g ID=Lus10027007.BGIv1.0 annot-version=v1.0 ATGGCGAAAGGAAATCAGAAGAAAGAAGCCTGCTTACAAGAGAGCCAAAGTGGTGGCAAGGCATTTGCCTCCTTCAGTTCACTCTCTCGTTCGGAGCTAT TCTCCCACTTCAATCATTTCTTCTCCGATTGGGTCAATTGGGTCTCTTTCCGTCCCAGAAAGTCCAGGTGCTCCTCAGTATTCTGTGTTGCAGTCGAATA CGCCCCATTGCAGCAGCATGTTCCCAAGTCATACGCTAAGGATCGATAA
AA sequence Show only first row Show all	>Lus10027007 pacid=23151603 polypeptide=Lus10027007 locus=Lus10027007.g ID=Lus10027007.BGIv1.0 annot-version=v1.0 MAKGNQKKEACLQESQSGGKAFASFSSLSRSELFSHFNHFFSDWVNWVSFRPRKSRCSSVFCVAVEYAPLQQHVPKSYAKDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027007 [exp]	0	1
AT5G47570			unknown protein		Lus10008504 [exp]	6.5	0.7583
					Lus10012012 [exp]	7.2	0.7596
AT5G11280			unknown protein		Lus10026797 [exp]	8.9	0.7558
AT3G16175			Thioesterase superfamily prote...		Lus10006834 [exp]	10.4	0.7262
					Lus10033923 [exp]	15.0	0.7706
					Lus10038255 [exp]	18.1	0.7382
AT1G06980			unknown protein		Lus10020386 [exp]	18.3	0.7487
					Lus10042085 [exp]	24.0	0.7116
AT2G44210			Protein of Unknown Function (D...		Lus10005502 [exp]	26.9	0.6580
					Lus10009774 [exp]	29.2	0.7103

Compare expression of checked genes

Lus10027007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.