Lus10027021 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31570 266 / 2e-92 ATGPX2 glutathione peroxidase 2 (.1)
AT2G43350 250 / 1e-85 ATGPX3 glutathione peroxidase 3 (.1.2)
AT4G31870 248 / 4e-84 ATGPX7 glutathione peroxidase 7 (.1)
AT4G11600 242 / 4e-82 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT2G25080 238 / 3e-80 ATGPX1 glutathione peroxidase 1 (.1)
AT1G63460 225 / 2e-76 ATGPX8 glutathione peroxidase 8 (.1)
AT2G48150 211 / 2e-70 ATGPX4 glutathione peroxidase 4 (.1)
AT3G63080 210 / 2e-70 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008022 258 / 5e-89 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10008499 255 / 4e-87 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008537 252 / 6e-87 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10042418 248 / 4e-84 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10026887 248 / 6e-84 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10008023 235 / 6e-79 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10003421 236 / 2e-78 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1)
Lus10000601 227 / 4e-77 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
Lus10000603 220 / 3e-74 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G126600 294 / 4e-103 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.003G126100 253 / 2e-86 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105200 245 / 5e-84 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.006G265400 245 / 4e-83 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.001G105100 240 / 8e-82 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.014G138800 215 / 4e-72 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 160 / 2e-50 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10027021 pacid=23151526 polypeptide=Lus10027021 locus=Lus10027021.g ID=Lus10027021.BGIv1.0 annot-version=v1.0
ATGGCAGATTCTTCTTCTCTTTTACCTCCCAACTCCATCTATGACTTCACTGTTAAGGATATAAAGGGGAGTGATGTGAATCTGAGTGAATACAAGGGGA
AGGTTCTTCTCATCGTCAATGTTGCTTCCAAATGTGGGTTGACACACGCAAACTACAAGGAATTGAACGTGCTATACCAGAAATACAAAGACCAAGGGCT
AGAGATCCTAGCATTCCCTTGCAACCAGTTTGGTGGACAAGAACCAGGAACCATTGACGAAATCCAGGACACTGTATGCACCATCTTCAAAGCTGAATTC
CCAATCTTTGACAAGGTCGATGTGAACGGGAAGAACACTGCGGAGGTGTACAAGTACTTGAAGTCGGAGAAAGGAGGGTTTCTGGGAGATGCAATCAAAT
GGAACTTCACAAAGTTCCTGGTGAACAAACAAGGCAAAGTCATGGAGCGTTACGCTCCCACTACTTCGCCTCTTAAGATCGAGAAGGATATCCAGAACCT
GTTGGAAATTGCTTCTGCTTGA
AA sequence
>Lus10027021 pacid=23151526 polypeptide=Lus10027021 locus=Lus10027021.g ID=Lus10027021.BGIv1.0 annot-version=v1.0
MADSSSLLPPNSIYDFTVKDIKGSDVNLSEYKGKVLLIVNVASKCGLTHANYKELNVLYQKYKDQGLEILAFPCNQFGGQEPGTIDEIQDTVCTIFKAEF
PIFDKVDVNGKNTAEVYKYLKSEKGGFLGDAIKWNFTKFLVNKQGKVMERYAPTTSPLKIEKDIQNLLEIASA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G31570 ATGPX2 glutathione peroxidase 2 (.1) Lus10027021 0 1
AT5G19930 Protein of unknown function DU... Lus10033068 2.0 0.9506
AT4G30600 signal recognition particle re... Lus10035066 3.3 0.9606
AT3G57530 ATCPK32, CDPK32... calcium-dependent protein kina... Lus10026742 5.2 0.9566
AT3G57090 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide ... Lus10036023 5.5 0.9444
AT3G62150 ABCB21, PGP21 ATP-binding cassette B21, P-gl... Lus10000052 5.5 0.9592
AT1G03590 Protein phosphatase 2C family ... Lus10033708 8.5 0.9402
AT2G35736 unknown protein Lus10004354 12.1 0.9014
AT3G51660 Tautomerase/MIF superfamily pr... Lus10000344 14.1 0.9357
AT4G14880 OLD3, CYTACS1, ... ONSET OF LEAF DEATH 3, O-acety... Lus10015947 16.6 0.9228
AT5G56260 Ribonuclease E inhibitor RraA/... Lus10027126 17.9 0.9165

Lus10027021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.