Lus10027024 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46680 154 / 3e-44 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G05670 89 / 2e-20 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT5G61990 86 / 3e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12700 84 / 1e-18 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
AT5G57250 83 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 82 / 7e-18 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12620 81 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12300 80 / 2e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39710 80 / 3e-17 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G02150 79 / 6e-17 EMB2794 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039036 315 / 7e-107 AT5G46680 399 / 1e-135 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10025564 276 / 2e-92 AT5G46680 276 / 2e-88 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10008185 86 / 5e-19 AT1G19290 864 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027916 82 / 6e-18 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019524 82 / 1e-17 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042529 81 / 2e-17 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027974 79 / 6e-17 AT1G19290 480 / 1e-156 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012068 79 / 6e-17 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 79 / 6e-17 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G006500 194 / 1e-59 AT5G46680 444 / 1e-153 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.010G035700 94 / 3e-22 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.002G109500 82 / 5e-18 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.004G013300 82 / 7e-18 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G131400 81 / 9e-18 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G105600 81 / 1e-17 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G368700 81 / 2e-17 AT5G55840 1272 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G137200 80 / 4e-17 AT1G13630 805 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.006G242200 79 / 8e-17 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G147700 79 / 9e-17 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10027024 pacid=23151570 polypeptide=Lus10027024 locus=Lus10027024.g ID=Lus10027024.BGIv1.0 annot-version=v1.0
ATGAAGAGTAAAGGGTATACTTCTGATGGCTTTGGGTATTGCACGGCTATGGGTGCTCTGCTCAAGTTTGGTAAAGTTGAAGAGGCGGCTAGGTTCAAGG
ATGAGATGATAAACAATGGTATTGAGCTTGATTTGGTGTCATATAATACACTACTGAATATCTCACGTAAAGAAGGTAAAATGGAAGAATTTTATTCTTT
GAGAGACCAAATCAAAAAGAGTGGTTTGGAACATGATAAATACACACATACTATATTTGTGGACGTATTGTGCAAGGAAGGTTATATTGAGCGGGCACAA
CAACGCCTGAAGGAAATGAATACGATGGGTTTTCATTCCACTTCAGCTGCTACAAACTCTGTTATTGACGGATTAGCTAAAGCTGGCAATTATGAGCTTG
CTACAAAAATGTTGGCATCGATGAAGGTGAGAGATGCCTTTTCCTATTCATCATTGGTTTATAATCTTTCCAAAGCTATAAGGTTCAGATGTGCTGAGGA
GCTCTTGCTCTACTGCGTGAAACAAAGGATGAAATTACTCCCGGCTGCGAAATGGGCTCTTCTTGATGGTCTCCAATATGATGGCTTTCAAGCAGAAGCT
AGGATACTTAGGGATATAATTCGACGTTTTCAGATTATACGACCGTGA
AA sequence
>Lus10027024 pacid=23151570 polypeptide=Lus10027024 locus=Lus10027024.g ID=Lus10027024.BGIv1.0 annot-version=v1.0
MKSKGYTSDGFGYCTAMGALLKFGKVEEAARFKDEMINNGIELDLVSYNTLLNISRKEGKMEEFYSLRDQIKKSGLEHDKYTHTIFVDVLCKEGYIERAQ
QRLKEMNTMGFHSTSAATNSVIDGLAKAGNYELATKMLASMKVRDAFSYSSLVYNLSKAIRFRCAEELLLYCVKQRMKLLPAAKWALLDGLQYDGFQAEA
RILRDIIRRFQIIRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46680 Pentatricopeptide repeat (PPR-... Lus10027024 0 1
AT5G66900 Disease resistance protein (CC... Lus10034761 1.0 0.8853
AT1G05670 Pentatricopeptide repeat (PPR-... Lus10027025 1.4 0.8667
AT1G27170 transmembrane receptors;ATP bi... Lus10020533 1.7 0.8664
AT5G17690 AtLHP1, LHP1, T... TERMINAL FLOWER 2, LIKE HETERO... Lus10001338 2.2 0.8462
AT5G47860 Protein of unknown function (D... Lus10042222 3.5 0.8633
AT4G18880 HSF AT-HSFA4A ,HSF ... ARABIDOPSIS THALIANA HEAT SHOC... Lus10005420 4.6 0.8399
AT5G43470 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PAR... Lus10025625 5.3 0.8143
AT3G12050 Aha1 domain-containing protein... Lus10029141 6.0 0.7933
AT4G12010 Disease resistance protein (TI... Lus10023051 9.5 0.8156
AT1G55320 AAE18 acyl-activating enzyme 18 (.1.... Lus10034997 9.9 0.8290

Lus10027024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.