Lus10027025 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46680 69 / 7e-14 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G05670 61 / 3e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT2G32630 59 / 2e-10 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G63080 59 / 2e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 59 / 2e-10 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G03560 58 / 3e-10 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G62914 57 / 1e-09 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G63400 56 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63150 55 / 5e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02060 55 / 6e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041927 63 / 7e-12 AT5G18475 341 / 3e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020134 58 / 5e-10 AT1G12700 254 / 3e-78 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10021645 57 / 8e-10 AT2G37230 1041 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030513 57 / 1e-09 AT3G09060 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10034721 56 / 2e-09 AT2G37230 1041 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036020 56 / 2e-09 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10005540 56 / 3e-09 AT5G18475 562 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035735 56 / 3e-09 AT4G11690 526 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10036238 56 / 3e-09 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G006500 72 / 8e-15 AT5G46680 444 / 1e-153 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.013G149800 62 / 2e-11 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050300 61 / 4e-11 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050240 61 / 4e-11 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046100 60 / 7e-11 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G068700 59 / 2e-10 AT2G36240 509 / 4e-178 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.004G074500 59 / 2e-10 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G034400 59 / 2e-10 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G025600 58 / 4e-10 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G045000 58 / 5e-10 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10027025 pacid=23151550 polypeptide=Lus10027025 locus=Lus10027025.g ID=Lus10027025.BGIv1.0 annot-version=v1.0
ATGCCTCACGGGGAGTGCTTCCTGATGTCGTCACTTTCAATACGCTCATCAACGCCTACTGTTGTCTCGTCAGCTTCGAGGCTGCTTATACTATACTCGT
TAGAATGGAAAAAAGCTGGGATTGGACCAGATGTGGTATCTTTCAATACTTTGATCGCCGGTGTTACTAGACGCCGCTTGTTCGATAAGGCCACCTACCT
GTTCGAGGAGGAAATGCCTCAAAGAAACATTTCCCCTGATATTTTGACCTTGAACACCATGCACTCTTTCTTCCAGCAGAGAAAGACCGGGGAAGCTTAT
AAGATCTTGCCAATGATTGATGATGGGTTGTGTAAAGCTGGGAAATTGGGAGCTGCTAGACGGGTTATTCGAGAATTCGAGGCTTCTGGGCACGCTGCCA
ATGCTATAACTTATACCACAGATGATGAATTGTTGGTTTATTGTCTCGGACACCAGACCGCTCGTGCCCGCCCATTCTGTCTCGCCCTAAGTGGAATGGC
TCTCTTAGTTAGGCTGCGCCCCGACCCGAGTCCCCACGTCTAA
AA sequence
>Lus10027025 pacid=23151550 polypeptide=Lus10027025 locus=Lus10027025.g ID=Lus10027025.BGIv1.0 annot-version=v1.0
MPHGECFLMSSLSIRSSTPTVVSSASRLLILYSLEWKKAGIGPDVVSFNTLIAGVTRRRLFDKATYLFEEEMPQRNISPDILTLNTMHSFFQQRKTGEAY
KILPMIDDGLCKAGKLGAARRVIREFEASGHAANAITYTTDDELLVYCLGHQTARARPFCLALSGMALLVRLRPDPSPHV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05670 Pentatricopeptide repeat (PPR-... Lus10027025 0 1
AT5G46680 Pentatricopeptide repeat (PPR-... Lus10027024 1.4 0.8667
AT5G17690 AtLHP1, LHP1, T... TERMINAL FLOWER 2, LIKE HETERO... Lus10001338 3.5 0.8183
AT4G36210 Protein of unknown function (D... Lus10028363 7.3 0.8236
AT3G12050 Aha1 domain-containing protein... Lus10029141 7.4 0.7838
AT3G16785 PLDZ1, PLDZETA1... PHOSPHOLIPASE D ZETA1, PHOSPHO... Lus10029873 9.5 0.7800
AT4G36980 unknown protein Lus10019346 10.9 0.7888
AT4G38470 STY46 serine/threonine/tyrosine kina... Lus10005630 15.0 0.7407
AT5G45190 Cyclin family protein (.1.2) Lus10021927 15.9 0.8307
AT5G49970 PDX3, ATPPOX HOMOLOG OF YEAST PYRIDOXINE AU... Lus10002098 17.5 0.7964
AT3G51130 unknown protein Lus10014270 22.8 0.7997

Lus10027025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.