Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27890 68 / 3e-15 HSP20-like chaperones superfamily protein (.1) AT5G53400 67 / 1e-14 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018250 [exp] 118 / 3e-35 AT5G53400 213 / 4e-69 BOBBER1, HSP20-like chaperones superfamily protein (.1) Lus10040656 [exp] 109 / 1e-31 AT5G53400 216 / 3e-70 BOBBER1, HSP20-like chaperones superfamily protein (.1) Lus10005009 [exp] 68 / 4e-15 AT5G53400 306 / 2e-103 BOBBER1, HSP20-like chaperones superfamily protein (.1) Lus10019028 [exp] 67 / 1e-14 AT5G53400 324 / 3e-111 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G100900 [exp] 75 / 1e-17 AT5G53400 232 / 2e-75 BOBBER1, HSP20-like chaperones superfamily protein (.1) Potri.001G132500 [exp] 69 / 8e-16 AT5G53400 225 / 1e-73 BOBBER1, HSP20-like chaperones superfamily protein (.1) Potri.015G013900 [exp] 65 / 4e-14 AT5G53400 283 / 8e-95 BOBBER1, HSP20-like chaperones superfamily protein (.1) Potri.012G014100 [exp] 64 / 1e-13 AT5G53400 277 / 4e-93 BOBBER1, HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [flax] [poplar] HSP20 PF04969 [flax] [poplar] CS CS domain
Representative CDS sequence Show only first row Show all	>Lus10027048 pacid=23151557 polypeptide=Lus10027048 locus=Lus10027048.g ID=Lus10027048.BGIv1.0 annot-version=v1.0 ATGAGATCGAAGCAGATCACCTGCGAGATTAAGAAGACATCCCTAAAACTCGAAATCAAGGGACCGCTGGCGGCAACGATCATTGATGGGGAGCTGAGCG GCGTGGAGAAAGTCTGGGAATCGTTCTGGAACTTGGAGGAGAAGAGGATTGTCTCGGTTCTGCTGACGAGATCGGCGGACGACAAGAAGAATTGGTGGAA GTCGCTGATGAAAGGAGGGCTGGAGATCGACACGCATTAA
AA sequence Show only first row Show all	>Lus10027048 pacid=23151557 polypeptide=Lus10027048 locus=Lus10027048.g ID=Lus10027048.BGIv1.0 annot-version=v1.0 MRSKQITCEIKKTSLKLEIKGPLAATIIDGELSGVEKVWESFWNLEEKRIVSVLLTRSADDKKNWWKSLMKGGLEIDTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27890			HSP20-like chaperones superfam...		Lus10027048 [exp]	0	1
AT1G03390			HXXXD-type acyl-transferase fa...		Lus10033079 [exp]	1.0	0.8910
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Lus10027880 [exp]	2.2	0.8358
AT1G71690			Protein of unknown function (D...		Lus10003512 [exp]	4.0	0.8807
AT3G55390			Uncharacterised protein family...		Lus10001709 [exp]	5.3	0.8378
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Lus10003663 [exp]	10.5	0.7965
					Lus10018552 [exp]	11.1	0.8590
					Lus10009357 [exp]	12.3	0.8017
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Lus10035312 [exp]	14.1	0.8204
AT3G53810			Concanavalin A-like lectin pro...		Lus10040774 [exp]	15.3	0.8279
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015354 [exp]	16.9	0.8329

Compare expression of checked genes

Lus10027048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.