Lus10027049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24070 63 / 3e-13 Peroxidase superfamily protein (.1)
AT2G43480 51 / 4e-09 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025586 86 / 2e-21 AT5G24070 418 / 6e-147 Peroxidase superfamily protein (.1)
Lus10004804 78 / 1e-18 AT5G24070 412 / 1e-144 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G132800 75 / 1e-17 AT2G43480 446 / 2e-158 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027049 pacid=23151598 polypeptide=Lus10027049 locus=Lus10027049.g ID=Lus10027049.BGIv1.0 annot-version=v1.0
ATGGGTGGTGGTGGCGGGGGCGGTGGTGATGATGGTGGCGGTGGGATGGTGGAGGGGGCGATAGGGCTGCAGCCGCCGGTGAAGTTGAAGTGGCATTACT
ACCGCCTCAACAGGACATGCAAGTACGCGGAGGAATACGTGAAGCACCAAGTCCTCCGCTTGCTCTATTTCGACTGTTTCGTCACCGTCGAGAACAAGCA
GAAGAAGGAAGAAGATGAAAATGGAGTCTGA
AA sequence
>Lus10027049 pacid=23151598 polypeptide=Lus10027049 locus=Lus10027049.g ID=Lus10027049.BGIv1.0 annot-version=v1.0
MGGGGGGGGDDGGGGMVEGAIGLQPPVKLKWHYYRLNRTCKYAEEYVKHQVLRLLYFDCFVTVENKQKKEEDENGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24070 Peroxidase superfamily protein... Lus10027049 0 1
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10020731 1.7 1.0000
Lus10005761 3.2 1.0000
AT5G11880 Pyridoxal-dependent decarboxyl... Lus10026354 5.1 1.0000
Lus10024762 5.7 1.0000
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10032588 6.6 1.0000
AT5G42020 BIP2, BIP luminal binding protein, Heat ... Lus10017020 7.2 1.0000
Lus10020426 7.2 1.0000
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10031081 7.9 1.0000
AT1G69530 ATHEXPALPHA1.2,... EXPANSIN 1, expansin A1 (.1.2.... Lus10003438 9.0 1.0000
Lus10003831 10.0 1.0000

Lus10027049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.