Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24070 63 / 3e-13 Peroxidase superfamily protein (.1) AT2G43480 51 / 4e-09 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025586 [exp] 86 / 2e-21 AT5G24070 418 / 6e-147 Peroxidase superfamily protein (.1) Lus10004804 [exp] 78 / 1e-18 AT5G24070 412 / 1e-144 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G132800 [exp] 75 / 1e-17 AT2G43480 446 / 2e-158 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027049 pacid=23151598 polypeptide=Lus10027049 locus=Lus10027049.g ID=Lus10027049.BGIv1.0 annot-version=v1.0 ATGGGTGGTGGTGGCGGGGGCGGTGGTGATGATGGTGGCGGTGGGATGGTGGAGGGGGCGATAGGGCTGCAGCCGCCGGTGAAGTTGAAGTGGCATTACT ACCGCCTCAACAGGACATGCAAGTACGCGGAGGAATACGTGAAGCACCAAGTCCTCCGCTTGCTCTATTTCGACTGTTTCGTCACCGTCGAGAACAAGCA GAAGAAGGAAGAAGATGAAAATGGAGTCTGA
AA sequence Show only first row Show all	>Lus10027049 pacid=23151598 polypeptide=Lus10027049 locus=Lus10027049.g ID=Lus10027049.BGIv1.0 annot-version=v1.0 MGGGGGGGGDDGGGGMVEGAIGLQPPVKLKWHYYRLNRTCKYAEEYVKHQVLRLLYFDCFVTVENKQKKEEDENGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24070			Peroxidase superfamily protein...		Lus10027049 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10020731 [exp]	1.7	1.0000
					Lus10005761 [exp]	3.2	1.0000
AT5G11880			Pyridoxal-dependent decarboxyl...		Lus10026354 [exp]	5.1	1.0000
					Lus10024762 [exp]	5.7	1.0000
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10032588 [exp]	6.6	1.0000
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Lus10017020 [exp]	7.2	1.0000
					Lus10020426 [exp]	7.2	1.0000
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10031081 [exp]	7.9	1.0000
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Lus10003438 [exp]	9.0	1.0000
					Lus10003831 [exp]	10.0	1.0000

Compare expression of checked genes

Lus10027049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.