Lus10027052 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033051 139 / 5e-43 ND /
Lus10024749 129 / 4e-39 ND /
Lus10006395 129 / 8e-39 ND /
Lus10003831 131 / 1e-38 ND /
Lus10004816 119 / 1e-33 AT5G01470 342 / 6e-118 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
Lus10002987 106 / 6e-31 ND /
Lus10021791 99 / 9e-29 ND /
Lus10036998 107 / 1e-28 AT2G44220 247 / 9e-77 Protein of Unknown Function (DUF239) (.1)
Lus10022574 100 / 7e-28 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027052 pacid=23151608 polypeptide=Lus10027052 locus=Lus10027052.g ID=Lus10027052.BGIv1.0 annot-version=v1.0
ATGAGTACTACGGGAGTTGATGTCAGTGACGGAATTGATTACTCTGACTGGTTATTATCTGACGATGTGTATGACACTGTTGGTGAAGCGGCGCAAGCAG
CAAAAAAGATTGTTATAACGCTTAATTTCCATCTGATCAATGAGTCCAACAAAAGCAATAACTCGAAAAAGGAGTGTCGGGTGTATCTGTATTGCTCACA
TGGACTTGCTCGCAAGTTTGACGGTTCAGACCCGCCGAAATGGGCGACGAAGTCAAAGAAGTGTAATTGTCCATTCAAACTTCCCAAAATTTTGAATGTG
TGA
AA sequence
>Lus10027052 pacid=23151608 polypeptide=Lus10027052 locus=Lus10027052.g ID=Lus10027052.BGIv1.0 annot-version=v1.0
MSTTGVDVSDGIDYSDWLLSDDVYDTVGEAAQAAKKIVITLNFHLINESNKSNNSKKECRVYLYCSHGLARKFDGSDPPKWATKSKKCNCPFKLPKILNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027052 0 1
AT2G39730 RCA rubisco activase (.1.2.3) Lus10003234 3.2 0.8264
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10041290 3.5 0.7614
AT1G07645 ATDSI-1VOC dessication-induced 1VOC super... Lus10016574 3.5 0.7192
AT1G28270 RALFL4 ralf-like 4 (.1) Lus10005541 3.6 0.6834
AT3G02100 UDP-Glycosyltransferase superf... Lus10015753 4.5 0.8184
AT2G07180 Protein kinase superfamily pro... Lus10008546 4.7 0.6895
AT4G10850 SWEET7, AtSWEET... Nodulin MtN3 family protein (.... Lus10017302 10.6 0.6543
AT3G25180 CYP82G1 cytochrome P450, family 82, su... Lus10038203 12.1 0.7693
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10002190 16.2 0.5432
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10008524 19.4 0.6627

Lus10027052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.