Lus10027057 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76750 49 / 4e-08 Protein of unknown function (DUF1278) (.1)
AT3G03272 48 / 6e-08 Protein of unknown function (DUF1278) (.1)
AT5G17340 45 / 2e-06 Putative membrane lipoprotein (.1)
AT2G21750 38 / 0.0006 Protein of unknown function (DUF1278) (.1)
AT5G53742 37 / 0.0006 Protein of unknown function (DUF1278) (.1)
AT4G39340 37 / 0.0008 Protein of unknown function (DUF1278) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025591 183 / 1e-60 AT1G76750 48 / 6e-08 Protein of unknown function (DUF1278) (.1)
Lus10004598 45 / 1e-06 AT1G76750 131 / 2e-39 Protein of unknown function (DUF1278) (.1)
Lus10004548 44 / 7e-06 AT1G76750 130 / 4e-39 Protein of unknown function (DUF1278) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G306600 46 / 8e-07 AT2G21740 112 / 7e-33 Protein of unknown function (DUF1278) (.1)
Potri.001G306700 45 / 1e-06 AT1G76750 113 / 3e-33 Protein of unknown function (DUF1278) (.1)
Potri.001G353600 41 / 4e-05 AT1G76750 120 / 1e-35 Protein of unknown function (DUF1278) (.1)
Potri.009G077000 38 / 0.0008 AT1G76750 127 / 6e-38 Protein of unknown function (DUF1278) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence
>Lus10027057 pacid=23151568 polypeptide=Lus10027057 locus=Lus10027057.g ID=Lus10027057.BGIv1.0 annot-version=v1.0
ATGGCGAATCAGAACCTTTCCCTCCTACGCATACATACACTCCTCGTCATCCTCCTCGGCTTCCTCTTCCTGCCAGCGTGGCAGCAACAGCACCCAGCTA
AGGCTGCTCAGCAGCAGTATCCTGCGCCGGCGGCGTATTACCCACAATTTCCGACAGCCCGTCCGGCGCTTTGGGACCCGTACGTGTACGGGCAGTGCGT
GGGGTCGTTTATCGCGGAGGAATCTTGCACAGGGGAGATCATGTCGTCGTTCTGGACCGGACGGGTTTACCTGGCGCCCGGTTGCTGCGACTCAGTCCGC
CAGGTCAGCGACGAGTGCATCCCGACGGCGTTTTCCTTGCTGGCGAATCCTTTCTTTGGATACGCTCTGAAAGGTTACTGTGTAACTCGGCCTTGGATCC
ATTCGCTGCCTTGA
AA sequence
>Lus10027057 pacid=23151568 polypeptide=Lus10027057 locus=Lus10027057.g ID=Lus10027057.BGIv1.0 annot-version=v1.0
MANQNLSLLRIHTLLVILLGFLFLPAWQQQHPAKAAQQQYPAPAAYYPQFPTARPALWDPYVYGQCVGSFIAEESCTGEIMSSFWTGRVYLAPGCCDSVR
QVSDECIPTAFSLLANPFFGYALKGYCVTRPWIHSLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G76750 Protein of unknown function (D... Lus10027057 0 1
Lus10037427 1.0 0.7990
AT2G43040 NPG1 no pollen germination 1, tetra... Lus10033595 2.8 0.7559
AT1G66170 MMD1 MALE MEIOCYTE DEATH 1, RING/FY... Lus10031357 8.8 0.6453
Lus10007681 12.6 0.7101
AT3G01180 ATSS2 starch synthase 2 (.1) Lus10033014 13.7 0.7268
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10038514 14.0 0.7522
AT3G49680 ATBCAT-3 ,BCAT3 branched-chain aminotransferas... Lus10011604 14.5 0.6985
AT5G65280 GCL1 GCR2-like 1 (.1) Lus10025736 16.5 0.7531
AT3G27470 Protein of unknown function (D... Lus10022287 18.3 0.7426
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10008713 20.7 0.6531

Lus10027057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.