Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34620 135 / 6e-43 SSR16 small subunit ribosomal protein 16 (.1) AT5G56940 131 / 7e-41 Ribosomal protein S16 family protein (.1) ATCG00050 49 / 6e-09 ATCG00050.1, RPS16 ribosomal protein S16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025592 [exp] 211 / 5e-73 AT4G34620 137 / 2e-43 small subunit ribosomal protein 16 (.1) Lus10014281 [exp] 132 / 6e-41 AT5G56940 210 / 2e-71 Ribosomal protein S16 family protein (.1) Lus10025984 [exp] 130 / 2e-40 AT5G56940 208 / 1e-70 Ribosomal protein S16 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G128200 [exp] 147 / 2e-47 AT4G34620 139 / 6e-44 small subunit ribosomal protein 16 (.1) Potri.004G217400 [exp] 135 / 2e-42 AT5G56940 188 / 7e-63 Ribosomal protein S16 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00886 [flax] [poplar] Ribosomal_S16 Ribosomal protein S16
Representative CDS sequence Show only first row Show all	>Lus10027058 pacid=23151509 polypeptide=Lus10027058 locus=Lus10027058.g ID=Lus10027058.BGIv1.0 annot-version=v1.0 ATGGCAGTGAAGATACGGTTTGCAAGGCACGGTTGCACCCACAGGCCATTCTACAGGATTGTTGTTGCTAACAGCCAATCCCCTCGCGACGGAAGGTTCA TTCAGATTATTGGTTTCTACGATCCCTTGGCAGCAAAGGATGACACCAAGAAGATGGGTCTCAACTATGACAGAGCTAAGTATTGGCTATCTGTAGGGGC GCAGCCTTCAGATACAGTTCGACGCATCCTTATGCAAGCAGGTCTGATCGAGCCACCACCGATGGTGGTAATGGCAAACAAGGATGGGAATAAGGATGAA GCTTGA
AA sequence Show only first row Show all	>Lus10027058 pacid=23151509 polypeptide=Lus10027058 locus=Lus10027058.g ID=Lus10027058.BGIv1.0 annot-version=v1.0 MAVKIRFARHGCTHRPFYRIVVANSQSPRDGRFIQIIGFYDPLAAKDDTKKMGLNYDRAKYWLSVGAQPSDTVRRILMQAGLIEPPPMVVMANKDGNKDE A

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34620		SSR16	small subunit ribosomal protei...		Lus10027058 [exp]	0	1
AT1G75350		EMB2184	embryo defective 2184, Ribosom...		Lus10010639 [exp]	1.0	0.9886
AT5G54600			Translation protein SH3-like f...		Lus10005180 [exp]	1.4	0.9862
AT5G40950		RPL27	ribosomal protein large subuni...		Lus10041553 [exp]	2.0	0.9842
AT4G34620		SSR16	small subunit ribosomal protei...		Lus10025592 [exp]	2.4	0.9844
AT5G11450		PPD5	PsbP domain protein 5, Mog1/Ps...		Lus10001861 [exp]	2.6	0.9799
AT1G79850		PDE347, CS17, P...	PLASTID RIBOSOMAL SMALL SUBUNI...		Lus10025799 [exp]	2.8	0.9792
AT1G75350		EMB2184	embryo defective 2184, Ribosom...		Lus10033200 [exp]	3.2	0.9832
AT3G44890		RP19, RPL9	ribosomal protein L9 (.1)		Lus10041346 [exp]	4.2	0.9816
AT2G26340			unknown protein		Lus10000477 [exp]	4.4	0.9733
AT5G22340			unknown protein		Lus10043400 [exp]	4.9	0.9769

Compare expression of checked genes

Lus10027058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.