Lus10027065 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018199 135 / 4e-42 ND /
Lus10001476 122 / 1e-36 ND /
Lus10036342 118 / 1e-35 ND 43 / 2e-05
Lus10000712 115 / 3e-34 ND /
Lus10010058 115 / 4e-34 ND 36 / 0.007
Lus10027682 112 / 3e-33 AT1G48120 45 / 4e-06 hydrolases;protein serine/threonine phosphatases (.1)
Lus10006284 118 / 5e-33 ND /
Lus10033921 110 / 2e-32 ND 39 / 5e-04
Lus10036654 108 / 7e-32 AT1G50750 44 / 6e-06 Plant mobile domain protein family (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10536 PMD Plant mobile domain
Representative CDS sequence
>Lus10027065 pacid=23151616 polypeptide=Lus10027065 locus=Lus10027065.g ID=Lus10027065.BGIv1.0 annot-version=v1.0
ATGACGCACGCACACGTCGAGTGGCTTCCTTTCGGTTTACTAGATTTCAACGATGAGGCTCTATGGTCCTTGTATAGTGGTGACATACACGCATTTGACT
ACATCGAGCCATACGATCCCACTCGCGTCATGCGACAGTACGACTACCAACAGACGATGCCCGATGTGTTTTGCAAGCCAGAGTCTGCGTCGAGGCTGGG
GAATGGGGTGCATTATTCAGTGAAGCACTCTAGATGGAAGGCTTTATCCTTCTTCCACACTCGCAGTGTGTCAGGAGGTGCCGACGGTAACGCGTGTGCT
TAG
AA sequence
>Lus10027065 pacid=23151616 polypeptide=Lus10027065 locus=Lus10027065.g ID=Lus10027065.BGIv1.0 annot-version=v1.0
MTHAHVEWLPFGLLDFNDEALWSLYSGDIHAFDYIEPYDPTRVMRQYDYQQTMPDVFCKPESASRLGNGVHYSVKHSRWKALSFFHTRSVSGGADGNACA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027065 0 1

Lus10027065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.