Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032442 [exp] 151 / 6e-49 ND / Lus10010051 [exp] 152 / 1e-45 ND / Lus10042630 [exp] 135 / 1e-42 ND / Lus10004837 [exp] 139 / 2e-41 ND / Lus10017784 [exp] 139 / 2e-41 ND / Lus10009721 [exp] 135 / 5e-41 ND / Lus10013511 [exp] 136 / 7e-41 ND / Lus10002504 [exp] 130 / 2e-39 ND / Lus10007255 [exp] 126 / 8e-39 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027066 pacid=23151582 polypeptide=Lus10027066 locus=Lus10027066.g ID=Lus10027066.BGIv1.0 annot-version=v1.0 ATGACGGGTAAAGTGTCGGATATAAGAAAGTCGCTGGAAGACTCACAGATGAACGAGAAACCGTACGGGAAGTTGAACACGACGGTCAGCTTATGGGCGA TTGAGCTACTGGTTGAAGATCGGAAGTTGGTGAGGTCATGCACGTGTGTGATCCAGACTACCAAGGGGCTGCCTTGTATATGCGAAGCTCGACGATGTGT AGAAGAGGACAAATTGTTGTACAGGAGACACCTACATCGCTTTTGGGCTACATTGGACTACACGAACCCTCCCCAAACCCCTCCCGACCGTGCTGAGTGG GAAGATAACACCCGTTTGGCGAGAAACTATTGA
AA sequence Show only first row Show all	>Lus10027066 pacid=23151582 polypeptide=Lus10027066 locus=Lus10027066.g ID=Lus10027066.BGIv1.0 annot-version=v1.0 MTGKVSDIRKSLEDSQMNEKPYGKLNTTVSLWAIELLVEDRKLVRSCTCVIQTTKGLPCICEARRCVEEDKLLYRRHLHRFWATLDYTNPPQTPPDRAEW EDNTRLARNY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027066 [exp]	0	1
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009516 [exp]	2.4	1.0000
AT1G04670			unknown protein		Lus10004041 [exp]	2.4	1.0000
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10015158 [exp]	3.5	1.0000
					Lus10040397 [exp]	4.9	1.0000
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10042914 [exp]	5.2	0.9564
					Lus10006918 [exp]	5.3	1.0000
					Lus10007508 [exp]	5.5	1.0000
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009399 [exp]	5.7	0.9823
AT3G05610			Plant invertase/pectin methyle...		Lus10015211 [exp]	5.7	0.9973
AT2G25930		PYK20, ELF3	EARLY FLOWERING 3, hydroxyprol...		Lus10006857 [exp]	6.0	0.9983

Compare expression of checked genes

Lus10027066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.