Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59800 111 / 9e-33 unknown protein AT2G43795 70 / 2e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008338 [exp] 143 / 4e-45 AT3G59800 158 / 3e-49 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G139900 [exp] 122 / 6e-37 AT3G59800 150 / 6e-46 unknown protein Potri.017G010100 [exp] 121 / 2e-36 AT3G59800 147 / 4e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027089 pacid=23151604 polypeptide=Lus10027089 locus=Lus10027089.g ID=Lus10027089.BGIv1.0 annot-version=v1.0 ATGGGTAAAAATCAAGCTTACAAAGCTATGCAGAAAGCGAGGCTTGGCTCAAGCTCTGCAGGTCCTGATGAGGTTGAAGATGGCATGTCGCAGGTGGATG GTTCTTTTCATACACCAGAGTGGCATGCTGCTCGTTTGGCCAGCCTCAACACTTCTCATACAATTACCTGGGAGGAGTACAAGAAGAAGCAGAAGATGGG TCATGGGATCTTAGCATTGTTTGGGATGCATATCAAGGAATAA
AA sequence Show only first row Show all	>Lus10027089 pacid=23151604 polypeptide=Lus10027089 locus=Lus10027089.g ID=Lus10027089.BGIv1.0 annot-version=v1.0 MGKNQAYKAMQKARLGSSSAGPDEVEDGMSQVDGSFHTPEWHAARLASLNTSHTITWEEYKKKQKMGHGILALFGMHIKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59800			unknown protein		Lus10027089 [exp]	0	1
					Lus10038678 [exp]	3.5	0.6887
					Lus10039750 [exp]	4.2	0.7474
					Lus10002152 [exp]	5.8	0.7472
					Lus10005187 [exp]	7.1	0.7472
					Lus10010117 [exp]	8.2	0.7472
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025408 [exp]	9.2	0.7472
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10040338 [exp]	10.1	0.7472
AT2G25010			Aminotransferase-like, plant m...		Lus10008761 [exp]	10.9	0.7472
AT1G13710		CYP78A5, KLUH	KLUH, "cytochrome P450, family...		Lus10015788 [exp]	12.3	0.7430
					Lus10012774 [exp]	12.4	0.7256

Compare expression of checked genes

Lus10027089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.