Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008349 [exp] 85 / 2e-20 AT3G59670 277 / 1e-86 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G127100 [exp] 42 / 1e-05 AT3G59670 377 / 2e-125 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027105 pacid=23151559 polypeptide=Lus10027105 locus=Lus10027105.g ID=Lus10027105.BGIv1.0 annot-version=v1.0 ATGGTGGGGGCAAGTTGCAATAAAGTGGCAGAGGAAGAGTATCATGAGAAAGGGGAGACAGGGGAAAGCAAAAATGTCAGTAAAGTTGCAAACTTTAAGA CAGAGGAAGTGGAAACAACAGCAACAGCAGGAGCAGGGGAATCGAGTAATCTGAAATCATGTTTAGCATTAGATATGCAGATCCCAACAAACAAGAGGAA GAGAGGGGAACGTAAAACTGGTTCTGGGACAGGTGGCTGGAAGAAGAAATGTTCAGGTGACGATGATGATGATAATCCTTAG
AA sequence Show only first row Show all	>Lus10027105 pacid=23151559 polypeptide=Lus10027105 locus=Lus10027105.g ID=Lus10027105.BGIv1.0 annot-version=v1.0 MVGASCNKVAEEEYHEKGETGESKNVSKVANFKTEEVETTATAGAGESSNLKSCLALDMQIPTNKRKRGERKTGSGTGGWKKKCSGDDDDDNP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027105 [exp]	0	1
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031568 [exp]	2.0	0.8279
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10005380 [exp]	6.0	0.8000
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	13.1	0.8046
AT1G76860			Small nuclear ribonucleoprotei...		Lus10040487 [exp]	25.1	0.7875
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	25.3	0.7736
AT5G13340			unknown protein		Lus10035960 [exp]	25.8	0.7871
AT3G07910			unknown protein		Lus10039527 [exp]	26.5	0.7638
AT3G24080			KRR1 family protein (.1.2)		Lus10025633 [exp]	33.4	0.7321
AT1G71430			unknown protein		Lus10040114 [exp]	36.7	0.7360
AT4G00390	GeBP		DNA-binding storekeeper protei...		Lus10018859 [exp]	36.7	0.7627

Compare expression of checked genes

Lus10027105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.