Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008352 [exp] 61 / 5e-12 AT5G23810 379 / 6e-125 amino acid permease 7 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027109 pacid=23151580 polypeptide=Lus10027109 locus=Lus10027109.g ID=Lus10027109.BGIv1.0 annot-version=v1.0 ATGTACGGCATCGGAATTGCCTACACGATCACTGCTGCGATTAGCATGAGGGCGATTCAGGAATCGACGTGCAGTAATATTTGCAATGATAACAAAGGAG GAGGAGGAGGAGGAGATGGTGGTGGTGGGTATGAGAGTGGTGGAGGGATGAGCTCATACATGATAATGTTTGGAGTGGCGGAGTTGTTCATGTCTCAAAT CCCACGACATTCAGTGGCTATCCAATGTCGCCGCCGTCATGTCTTTCGCTTACTCCTTCGTCGGTCTTGGTCTTGGCTTTGCTCGTGTCTTAGGTGCGTA CAACCATAA
AA sequence Show only first row Show all	>Lus10027109 pacid=23151580 polypeptide=Lus10027109 locus=Lus10027109.g ID=Lus10027109.BGIv1.0 annot-version=v1.0 MYGIGIAYTITAAISMRAIQESTCSNICNDNKGGGGGGDGGGGYESGGGMSSYMIMFGVAELFMSQIPRHSVAIQCRRRHVFRLLLRRSWSWLCSCLRCV QP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09220		AAP2	amino acid permease 2 (.1)		Lus10027109 [exp]	0	1
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Lus10034372 [exp]	2.8	0.7198
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016861 [exp]	8.2	0.6925
AT1G17800		AtENODL22	early nodulin-like protein 22 ...		Lus10020984 [exp]	12.4	0.6497
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024367 [exp]	20.4	0.5811
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Lus10031759 [exp]	25.5	0.5737
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10035547 [exp]	26.9	0.5829
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Lus10033233 [exp]	32.6	0.5578
					Lus10011594 [exp]	33.7	0.5578
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	34.7	0.5578
					Lus10016963 [exp]	35.7	0.5738

Compare expression of checked genes

Lus10027109 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.