Lus10027118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038642 186 / 2e-61 ND /
Lus10038483 100 / 2e-28 ND /
Lus10017801 102 / 1e-27 ND /
Lus10007416 80 / 3e-18 ND /
Lus10026444 77 / 7e-17 ND /
Lus10029488 76 / 2e-16 ND /
Lus10003025 71 / 1e-14 AT5G61000 57 / 2e-08 Replication factor-A protein 1-related (.1)
Lus10007415 69 / 6e-14 ND /
Lus10021668 65 / 2e-13 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027118 pacid=23151556 polypeptide=Lus10027118 locus=Lus10027118.g ID=Lus10027118.BGIv1.0 annot-version=v1.0
ATGTTCTTACATGATATTGTGGTGGCTGACCTTTCGGCCGAACTTCAACTCCGTCTCCAACACATTTGGCGGCTCTACAACCCGCCGGAGCCAGAACAAC
ATTTTTCCTTGGGTACTCTTTGGACAGACGCCGATGTATGCTTTCAGTGTAGGATACTCGGATTCAGGGCGATACGTTGCGTTATCTCGTCTTCGATTTG
GATAAACGCATCTTTGTTGGGGACATTTACAATCTGTCTGGAACACCGCATCGAAGGATACACCGAGCCTGATGATGTCGAGGAGGTCACTAGGCTCATT
GTCGAAGGCTCTATTTACAAAATCCACAATCACAATCTTATACGAGCTCGCTCTGCTATGCGCTCGTGTCCAGGAGATTTCTCAATTTTCATTCGCTCTG
AAAACCTGCTCCACAAAGTTGAGGAAGACCCTGAACGACCGTTTTCCCCGCATTTGCCTTCAACATAG
AA sequence
>Lus10027118 pacid=23151556 polypeptide=Lus10027118 locus=Lus10027118.g ID=Lus10027118.BGIv1.0 annot-version=v1.0
MFLHDIVVADLSAELQLRLQHIWRLYNPPEPEQHFSLGTLWTDADVCFQCRILGFRAIRCVISSSIWINASLLGTFTICLEHRIEGYTEPDDVEEVTRLI
VEGSIYKIHNHNLIRARSAMRSCPGDFSIFIRSENLLHKVEEDPERPFSPHLPST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027118 0 1
AT5G14490 NAC ANAC085 NAC domain containing protein ... Lus10003668 8.4 0.7298
AT5G02320 MYB MYB3R-5, ATMYB3... ARABIDOPSIS THALIANA MYB DOMAI... Lus10008010 15.7 0.7232
AT5G24280 GMI1 gamma-irradiation and mitomyci... Lus10022400 17.5 0.6655
Lus10000348 21.1 0.6963
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10034317 22.4 0.6993
AT5G02020 SIS Salt Induced Serine rich, unkn... Lus10021101 23.4 0.7133
AT1G05160 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, ... Lus10036670 24.2 0.6102
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10009876 27.3 0.6944
Lus10027352 32.1 0.6735
AT1G72100 late embryogenesis abundant do... Lus10000723 32.9 0.6845

Lus10027118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.