Lus10027129 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G26555 232 / 2e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G19830 73 / 2e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G05420 52 / 3e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G10060 52 / 7e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G12340 50 / 3e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G73655 49 / 7e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G43560 48 / 1e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G13410 48 / 1e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G60370 47 / 4e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G39710 46 / 6e-06 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032895 318 / 4e-108 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1)
Lus10036206 69 / 4e-14 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10038345 68 / 1e-13 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10035560 61 / 4e-11 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10027729 49 / 8e-07 AT3G10060 285 / 1e-97 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10024735 48 / 8e-07 AT5G45680 194 / 1e-63 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Lus10025889 47 / 9e-07 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1)
Lus10042897 48 / 1e-06 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10031121 49 / 2e-06 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G467100 246 / 4e-83 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G119800 76 / 1e-16 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.016G096600 52 / 5e-08 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G129200 52 / 1e-07 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2)
Potri.014G045600 50 / 3e-07 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.015G130900 47 / 3e-06 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2)
Potri.012G048300 47 / 3e-06 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.007G134600 46 / 8e-06 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.002G248200 44 / 1e-05 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1)
Potri.017G017500 44 / 4e-05 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10027129 pacid=23151530 polypeptide=Lus10027129 locus=Lus10027129.g ID=Lus10027129.BGIv1.0 annot-version=v1.0
ATGGATTGTCTCTCAAGTTTTAAAAGCCAATCACTCCTTCAAAAACTTATCTCTAGTATTGGCATCATCCTCATGAATTCTCTGTCCTCGCTCTCCAGTT
TTCCTCGGCCAAGGGCAAGGAAAACCAAAAATGCTAAGAATAAGCCTCTCATGGCTTCCACTCTAGTTTCTGCGTCCATGGGAATGAACAAGTTCCCAAG
GAGAGTGGTTTTGGAGTTGATTACCCACACTTCCTTTCTACCACTTCTTAATCCGGCATTGGCTGTTGTACCCAGTCCAGATATGGACGAGCCGCCTGAA
ATCATTCGGACGTTGAAGCTTGACAATGGGGTTAGGATTCAAGAGGTGATTGAAGGAGAAGGGCCAGAAGCTGGGGAAGGAGACCTCGTTGAGATAAACT
ATGTGTGTAGACGCTCTAATGGATATTTTGTACACAGCACTGTGGATCAGTTTAGTGGGGAAAGCTCGCCTGTCATGCTTCCTTTGAATGAGAACCAGAT
AATCAAAGGCTTGAAGGATGTTCTAATTGGGATGAAGGTTGGAGGCAAGAGAAGGGCTTTGATACCTCCATCTGTCGGATATGTGAATGAAAGCTTGAAA
CCAATCCCGGAGGAGTTCGGTCCTCGGCGTAGTCTGTTCTCACATGCGACGGAGCCTCTGATATTTGAGGTGCAACTCTTGAAAGTCTTGTGA
AA sequence
>Lus10027129 pacid=23151530 polypeptide=Lus10027129 locus=Lus10027129.g ID=Lus10027129.BGIv1.0 annot-version=v1.0
MDCLSSFKSQSLLQKLISSIGIILMNSLSSLSSFPRPRARKTKNAKNKPLMASTLVSASMGMNKFPRRVVLELITHTSFLPLLNPALAVVPSPDMDEPPE
IIRTLKLDNGVRIQEVIEGEGPEAGEGDLVEINYVCRRSNGYFVHSTVDQFSGESSPVMLPLNENQIIKGLKDVLIGMKVGGKRRALIPPSVGYVNESLK
PIPEEFGPRRSLFSHATEPLIFEVQLLKVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G26555 FKBP-like peptidyl-prolyl cis-... Lus10027129 0 1
AT4G12830 alpha/beta-Hydrolases superfam... Lus10002142 1.4 0.9630
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002906 2.8 0.9483
AT1G12250 Pentapeptide repeat-containing... Lus10024602 3.9 0.9446
AT2G03420 unknown protein Lus10036810 4.5 0.9418
AT1G54680 unknown protein Lus10018965 5.3 0.9359
AT3G56160 Sodium Bile acid symporter fam... Lus10019540 6.8 0.8863
AT3G16250 PnsB3, NDF4 Photosynthetic NDH subcomplex... Lus10025809 8.1 0.9414
AT3G17930 unknown protein Lus10042280 8.4 0.9250
AT5G27290 unknown protein Lus10033822 8.5 0.9379
AT1G54680 unknown protein Lus10033821 8.7 0.9197

Lus10027129 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.