Lus10027133 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35960 68 / 8e-15 NHL12 NDR1/HIN1-like 12 (.1)
AT2G35970 63 / 7e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT3G11660 63 / 7e-13 NHL1 NDR1/HIN1-like 1 (.1)
AT4G09590 61 / 5e-12 NHL22 NDR1/HIN1-like 22 (.1)
AT3G52470 60 / 1e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT5G06330 55 / 5e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT3G44220 47 / 4e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT5G22200 44 / 6e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT4G01410 42 / 2e-05 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
AT5G53730 40 / 0.0001 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000157 88 / 3e-22 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10016960 79 / 1e-18 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1)
Lus10021286 78 / 2e-18 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10029406 69 / 7e-15 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1)
Lus10004202 68 / 7e-15 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1)
Lus10043410 49 / 2e-07 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10034175 44 / 1e-05 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10013327 39 / 0.0004 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G204200 68 / 7e-15 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1)
Potri.016G071500 67 / 2e-14 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1)
Potri.009G019600 55 / 9e-10 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Potri.005G088000 48 / 2e-07 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Potri.012G006000 42 / 3e-05 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Potri.015G002400 41 / 6e-05 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Potri.014G106100 40 / 0.0002 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Potri.002G180000 39 / 0.0003 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence
>Lus10027133 pacid=23151587 polypeptide=Lus10027133 locus=Lus10027133.g ID=Lus10027133.BGIv1.0 annot-version=v1.0
ATGGCTGTCGTGGGTATCACCGTCTTCGTAATATGGGTCGTCCTCCGCCAAGCAAGCCATCCTTCATCCTACAAGATGCCACCGCCGGCTATGCCTTCAA
TAACACATCCACTCCCATTTTGCTCACCCCCAGTTTCCAGCTCACTTTCTCCACGCGGAACCCCAACGACAGAATCGGGATCTACTACGACCAGCTCGAA
GTTTTACGCAAAGTACCGGAGCGAGAAAATCACCTGCAAGGCTCAAGTCGAGCCGTTCTACCGGGGGCACAAGGAGACTGACGTCTGGTCTCCTTTAGCG
TACGGGAACGATGTTCCTGTATCTCCTTACAACGCAGCCACCCTCGTACTTGACCAGGCAAGGGTACTGTACTCGTGTCGATCAAGATGGACGGCCGCGT
CCGGTTGA
AA sequence
>Lus10027133 pacid=23151587 polypeptide=Lus10027133 locus=Lus10027133.g ID=Lus10027133.BGIv1.0 annot-version=v1.0
MAVVGITVFVIWVVLRQASHPSSYKMPPPAMPSITHPLPFCSPPVSSSLSPRGTPTTESGSTTTSSKFYAKYRSEKITCKAQVEPFYRGHKETDVWSPLA
YGNDVPVSPYNAATLVLDQARVLYSCRSRWTAASG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52470 Late embryogenesis abundant (L... Lus10027133 0 1
Lus10000351 4.8 0.8202
Lus10030838 6.2 0.7612
Lus10002886 6.8 0.8202
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 8.3 0.8202
AT5G02930 F-box/RNI-like superfamily pro... Lus10032255 9.6 0.8202
Lus10020530 10.0 0.6943
AT5G66870 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAI... Lus10006679 10.7 0.8202
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10041332 11.7 0.8202
Lus10014748 12.7 0.8202
AT3G26880 Plant self-incompatibility pro... Lus10022631 13.6 0.8202

Lus10027133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.