Lus10027144 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027144 pacid=23145576 polypeptide=Lus10027144 locus=Lus10027144.g ID=Lus10027144.BGIv1.0 annot-version=v1.0
ATGCGGCCTAACAATCTAACATACAGACGCAAATCGAACTGCACACTAAAAAAAAGAACCCTAAAGTCTCAACTAGGTTTCATAACGGACCCGGCAGCTT
CCGGCGATGACGTGGCCTCCTACTTTCCCGCCGCAGCACATCGGGATCTGGTCAATGGCTTCTCCGACACACTTCCTGCACTCACTTCTCGTCAGATCCC
TACTACACTCCACCATCCCATACACCTCATTTCCAATATCCCCCGTGGCAAACATCCTAGGCGCCACGTAAGCAGCCTCCTGTGCCAGCTGTCCCAGCAG
CCCCCTAGCCTTACCGTCGAACGACGTCGCATCGGTCGCGTTCGCCGTGTTGACCAGGTAGAAGAACCTGACCCGGCGGGTGTCGTCGACCTGACCGAAG
AAGTCCGAGTCCGAGTATTTGACGAAGCAGTTGTCGTACCATATGGCGGCGGATTTTGTTAG
AA sequence
>Lus10027144 pacid=23145576 polypeptide=Lus10027144 locus=Lus10027144.g ID=Lus10027144.BGIv1.0 annot-version=v1.0
MRPNNLTYRRKSNCTLKKRTLKSQLGFITDPAASGDDVASYFPAAAHRDLVNGFSDTLPALTSRQIPTTLHHPIHLISNIPRGKHPRRHVSSLLCQLSQQ
PPSLTVERRRIGRVRRVDQVEEPDPAGVVDLTEEVRVRVFDEAVVVPYGGGFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027144 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10013732 3.3 0.9656
AT1G17860 Kunitz family trypsin and prot... Lus10013731 9.9 0.9623
AT5G23530 ATCXE18 carboxyesterase 18 (.1) Lus10013774 15.1 0.8850
AT1G17860 Kunitz family trypsin and prot... Lus10007892 16.1 0.9540
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10001103 17.3 0.9510
AT1G49860 ATGSTF14 glutathione S-transferase (cla... Lus10036808 19.1 0.9504
AT1G76680 OPR1, ATOPR1 ARABIDOPSIS 12-OXOPHYTODIENOAT... Lus10001275 21.4 0.9399
AT1G62420 Protein of unknown function (D... Lus10003258 22.7 0.9479
AT1G17860 Kunitz family trypsin and prot... Lus10039209 24.0 0.9311
AT1G14550 Peroxidase superfamily protein... Lus10009898 28.3 0.9193

Lus10027144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.