Lus10027161 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25140 140 / 9e-43 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 114 / 6e-33 Oleosin family protein (.1)
AT5G51210 108 / 7e-31 OLEO3 oleosin3 (.1)
AT3G01570 78 / 2e-18 Oleosin family protein (.1)
AT5G40420 78 / 2e-18 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G27660 72 / 5e-16 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G07550 66 / 8e-15 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT3G18570 67 / 2e-14 Oleosin family protein (.1)
AT5G61610 66 / 3e-13 Oleosin family protein (.1)
AT1G48990 57 / 9e-11 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039683 221 / 3e-75 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10031387 192 / 6e-64 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10010943 186 / 3e-56 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10017460 160 / 4e-51 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10028822 153 / 1e-48 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10022141 93 / 4e-23 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017992 82 / 4e-20 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 77 / 5e-18 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10032461 74 / 4e-17 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G080000 137 / 4e-42 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 135 / 1e-41 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.006G234900 105 / 2e-29 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 93 / 1e-24 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G345800 80 / 1e-19 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.T125308 73 / 1e-16 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.015G081901 73 / 1e-16 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.017G071800 72 / 2e-16 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G059400 68 / 1e-14 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Potri.012G083400 66 / 3e-14 AT5G40420 97 / 2e-25 oleosin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10027161 pacid=23145537 polypeptide=Lus10027161 locus=Lus10027161.g ID=Lus10027161.BGIv1.0 annot-version=v1.0
ATGGATCAGTCGCACCAGACATACGCCGGAACCATGCAGAACCCGAGCTATGGCGGCGGAGGCACCATGCACCACCAGCAGCAGCAGCCGAGGTCTTACC
AGGCGGTGAAGGCGGCCACCGCAGCCACCGCGGGTGGATCCCTCATCGTTCTCTCCGGTCTCATCCTTACGGCCACCGTCATTTCACTCATCCTAGCCAC
CCCTCTCCTTGTCATCTTCAGCCCTGTTCTTGTCCCGGCTCTCATCACCGTCGGGCTCTTGATCACCGGGTTTCTGGCCTCCGGTGGGTTTGGTGTCGCC
GCCGTCACCGTCTTATCCTGGATCTATAGGTATGTGACCGGTGGGCACCCGGTGGGAGCGGATTCATTGGAGCAGGCGAGGTCGAGGCTGGCCGGGAAGG
CGAGGGAGGTGAAGGACAGGGCGTCGGAGTTTGGACAGCAGCACGTCACAGGTGGTCAACAGACCTCTTAA
AA sequence
>Lus10027161 pacid=23145537 polypeptide=Lus10027161 locus=Lus10027161.g ID=Lus10027161.BGIv1.0 annot-version=v1.0
MDQSHQTYAGTMQNPSYGGGGTMHHQQQQPRSYQAVKAATAATAGGSLIVLSGLILTATVISLILATPLLVIFSPVLVPALITVGLLITGFLASGGFGVA
AVTVLSWIYRYVTGGHPVGADSLEQARSRLAGKAREVKDRASEFGQQHVTGGQQTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10027161 0 1
AT2G25770 Polyketide cyclase/dehydrase a... Lus10026898 6.1 0.6090
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10025597 6.2 0.7754
AT4G27570 UDP-Glycosyltransferase superf... Lus10013367 11.2 0.7579
AT5G59190 subtilase family protein (.1) Lus10040747 15.2 0.7138
AT5G65530 Protein kinase superfamily pro... Lus10012727 17.9 0.7111
AT3G13690 Protein kinase protein with ad... Lus10009559 19.9 0.7100
Lus10003825 21.9 0.7059
Lus10029261 23.7 0.7059
AT5G56990 unknown protein Lus10029528 25.3 0.7059
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10014062 26.8 0.7059

Lus10027161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.