Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05205 149 / 2e-48 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039669 [exp] 175 / 6e-59 AT1G05205 145 / 4e-47 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G093501 [exp] 146 / 8e-48 AT1G05205 142 / 5e-46 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027173 pacid=23145373 polypeptide=Lus10027173 locus=Lus10027173.g ID=Lus10027173.BGIv1.0 annot-version=v1.0 ATGAGCGAAACGAGGCCGGTGCCGAGGAGGGAGAGCCCATGGGGGACGCCGCAGGAAGAGCACCGGCAGCCGAAGGCACATCGGTGCAACGATCGAGTTG AAGACGTTATTCAAGCTTGTTTCGAAGGAAACCCATTCAAGACAGTTCCTGGACCTTTCAAGCTCTTCTATGAATGCATGCGCTCCAAACCAGGGGAGGA ACCAACAGCACCCTACACCTACCTGCAGATTGATCCTCCAACAAGAGAGGCAAAACTTAAGTAA
AA sequence Show only first row Show all	>Lus10027173 pacid=23145373 polypeptide=Lus10027173 locus=Lus10027173.g ID=Lus10027173.BGIv1.0 annot-version=v1.0 MSETRPVPRRESPWGTPQEEHRQPKAHRCNDRVEDVIQACFEGNPFKTVPGPFKLFYECMRSKPGEEPTAPYTYLQIDPPTREAKLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05205			unknown protein		Lus10027173 [exp]	0	1
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Lus10031078 [exp]	2.8	0.8903
AT1G11240			unknown protein		Lus10018438 [exp]	3.5	0.8849
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10037606 [exp]	4.2	0.8896
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Lus10043114 [exp]	4.6	0.8744
AT3G05070			unknown protein		Lus10042290 [exp]	6.2	0.8529
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10029544 [exp]	6.9	0.8657
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	7.5	0.8719
AT3G12390			Nascent polypeptide-associated...		Lus10026133 [exp]	7.7	0.8521
					Lus10030724 [exp]	7.9	0.8518
AT2G47640			Small nuclear ribonucleoprotei...		Lus10007876 [exp]	8.1	0.8644

Compare expression of checked genes

Lus10027173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.