Lus10027174 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32380 173 / 9e-56 Transmembrane protein 97, predicted (.1)
AT1G05210 162 / 2e-51 Transmembrane protein 97, predicted (.1)
AT1G05220 146 / 2e-45 Transmembrane protein 97, predicted (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039668 288 / 4e-101 AT2G32380 194 / 5e-64 Transmembrane protein 97, predicted (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G117800 196 / 9e-65 AT2G32380 173 / 9e-56 Transmembrane protein 97, predicted (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence
>Lus10027174 pacid=23145421 polypeptide=Lus10027174 locus=Lus10027174.g ID=Lus10027174.BGIv1.0 annot-version=v1.0
ATGGGCGCGTTCGTGAAGCTGGTGGATTTCCTACTCTTCTTCGTCTTCCTCGTGATCGCTATAGCCGCTCCTCTGCTCGACGCGCAGACGTGCCTCCCTC
GCACCTACTTCCCTGATGCGTTGGTCGATCTGCATGAATGGTACGGCAAAGAGTTCGGAGACTATCTCACCGTCGAGAAGCCGCACTTCTTCGTCGGATT
GGTCTGGCTGGAGCTCTTCTTCCAGTGGCCGCTCGCCATCCTCAACCTGTATGCGATCTTGGCCTCCAAGCCGTGGTTCAACACCTCTTGCTTGATCTAC
GGCGTCTCCCTCATCTCCACCATGGTTCCGATTCTATCAGACATGGTGCTGTCTGAGAAAGCATCTGAGAAGCTGATGATGGTCTACGCCCCATTCCTTG
GAGCTGGTGTGGTCGCAATGCTGAGAGGGTTCGTCCCATATTCCGGGAAGAGCAGTTCCGGAGCCCCGAAGAGGCCAGCTTTCGGCAGGAAGAAGAGGGT
TTGA
AA sequence
>Lus10027174 pacid=23145421 polypeptide=Lus10027174 locus=Lus10027174.g ID=Lus10027174.BGIv1.0 annot-version=v1.0
MGAFVKLVDFLLFFVFLVIAIAAPLLDAQTCLPRTYFPDALVDLHEWYGKEFGDYLTVEKPHFFVGLVWLELFFQWPLAILNLYAILASKPWFNTSCLIY
GVSLISTMVPILSDMVLSEKASEKLMMVYAPFLGAGVVAMLRGFVPYSGKSSSGAPKRPAFGRKKRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32380 Transmembrane protein 97, pred... Lus10027174 0 1
AT1G61790 Oligosaccharyltransferase comp... Lus10007647 1.7 0.9615
AT3G08640 Protein of unknown function (D... Lus10003242 2.0 0.9537
AT3G28720 unknown protein Lus10015362 2.4 0.9356
AT4G35630 PSAT phosphoserine aminotransferase... Lus10005333 2.8 0.9398
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10002844 4.5 0.9388
AT5G08680 ATP synthase alpha/beta family... Lus10035263 4.6 0.9477
AT3G59390 unknown protein Lus10004383 6.5 0.9089
AT2G16800 high-affinity nickel-transport... Lus10027851 6.6 0.9088
AT5G41670 6-phosphogluconate dehydrogena... Lus10032341 6.9 0.9230
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Lus10021870 7.0 0.9320

Lus10027174 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.