Lus10027180 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17880 176 / 2e-57 ATBTF3 basic transcription factor 3 (.1)
AT1G73230 174 / 1e-56 Nascent polypeptide-associated complex NAC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039661 198 / 3e-66 AT1G17880 253 / 2e-87 basic transcription factor 3 (.1)
Lus10031551 190 / 7e-63 AT1G17880 255 / 2e-88 basic transcription factor 3 (.1)
Lus10015123 189 / 1e-62 AT1G17880 253 / 1e-87 basic transcription factor 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G141100 186 / 2e-61 AT1G73230 196 / 3e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.004G078300 186 / 3e-61 AT1G73230 197 / 2e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 170 / 4e-55 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 170 / 5e-55 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Lus10027180 pacid=23145476 polypeptide=Lus10027180 locus=Lus10027180.g ID=Lus10027180.BGIv1.0 annot-version=v1.0
ATGAAGATGGCCGGTTCGGTTCGCACCGGCGGGAAGGGAACCGTACGCAGAAAGAAGAAGGCAGTGCACAAATCGACCACCACAGACGACAAGAAGCTTC
AGGGGACACTGAAGAGGATTGGAGTAAACACAATCCCCGCCATTGAGGAGGTCAACATCTTCAAGGATGATTTGGTGATTCAGTTTCTGAACCCTAAAGT
GCAGGCTTCAATTGCTGCCAATACTTGGGTCATCACTGGTTCTCCTCAAACCAGAAAGTTGCAAGATATTCTTCCAGGAATCATCAACCAGCTTGGACCG
GATAACATGGACAACCTGAAGAAGTTGGCTGTGCAGTTCCAAAAGGAGGCACCAGCTGGTGCTGCAACCGAAGAAGAAGATGATGACGATGTACCAGAGC
TCGTAGCTGGGGAGACATTTGAAGCAGCAGCTGCGGAAGAGACTCGTGCTTAA
AA sequence
>Lus10027180 pacid=23145476 polypeptide=Lus10027180 locus=Lus10027180.g ID=Lus10027180.BGIv1.0 annot-version=v1.0
MKMAGSVRTGGKGTVRRKKKAVHKSTTTDDKKLQGTLKRIGVNTIPAIEEVNIFKDDLVIQFLNPKVQASIAANTWVITGSPQTRKLQDILPGIINQLGP
DNMDNLKKLAVQFQKEAPAGAATEEEDDDDVPELVAGETFEAAAAEETRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10027180 0 1
AT1G09640 Translation elongation factor ... Lus10002537 2.4 0.9599
AT4G24175 unknown protein Lus10017264 6.3 0.9235
AT1G09640 Translation elongation factor ... Lus10007148 8.4 0.9422
AT3G20330 PYRB PYRIMIDINE B (.1) Lus10013346 8.7 0.9390
AT5G10160 Thioesterase superfamily prote... Lus10015830 12.6 0.9281
AT3G25860 PLE2, LTA2 PLASTID E2 SUBUNIT OF PYRUVATE... Lus10034304 13.2 0.9270
AT4G01220 MGP4 male gametophyte defective 4, ... Lus10002153 15.9 0.9201
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 20.5 0.9269
AT3G47520 pNAD-MDH, MDH plastidic NAD-dependent malate... Lus10019096 21.2 0.9260
AT4G29510 ATPRMT1B, ATPRM... PROTEIN ARGININE METHYLTRANSFE... Lus10040546 22.0 0.9224

Lus10027180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.