Lus10027183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32360 47 / 2e-07 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039658 140 / 9e-45 AT2G32360 69 / 4e-16 Ubiquitin-like superfamily protein (.1)
Lus10015125 94 / 2e-26 AT2G32360 61 / 1e-12 Ubiquitin-like superfamily protein (.1)
Lus10031549 93 / 1e-24 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G122500 92 / 1e-25 AT2G32360 66 / 2e-14 Ubiquitin-like superfamily protein (.1)
Potri.017G037500 91 / 2e-25 AT2G32360 67 / 2e-15 Ubiquitin-like superfamily protein (.1)
Potri.017G037400 0 / 1 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Lus10027183 pacid=23145545 polypeptide=Lus10027183 locus=Lus10027183.g ID=Lus10027183.BGIv1.0 annot-version=v1.0
ATGATGGTGGTGGTGGAGATATTGACAGGCAGCCTCTTCCATGTCAATGTAGGAGAAGATGCCACAGTCGGTGATCTTAAACGAGAAATCGAATCACAGC
AGAAGCTACCTGTGGATCGCATGATACTCCTGCTCGGTGATGATCGTTTAGACGACGATGATAATTCGCTTCTTTCTGAGTGTAGAGTTCAAGATGGCTC
CCATGTCTATCTCTTCTTCAATCCTTTAGATGATGGCTCTTCTCATAGCTTCATTTTCGCTGGGCCGGAGGCCTCTTCTTGA
AA sequence
>Lus10027183 pacid=23145545 polypeptide=Lus10027183 locus=Lus10027183.g ID=Lus10027183.BGIv1.0 annot-version=v1.0
MMVVVEILTGSLFHVNVGEDATVGDLKREIESQQKLPVDRMILLLGDDRLDDDDNSLLSECRVQDGSHVYLFFNPLDDGSSHSFIFAGPEASS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32360 Ubiquitin-like superfamily pro... Lus10027183 0 1
AT5G44950 F-box/RNI-like/FBD-like domain... Lus10018863 4.0 0.7281
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Lus10026455 8.6 0.6650
AT1G53210 sodium/calcium exchanger famil... Lus10017657 10.5 0.6579
AT2G20990 SYT1, NTMC2TYPE... SYNAPTOTAGMIN 1, ARABIDOPSIS T... Lus10027842 16.0 0.6202
AT1G50750 Plant mobile domain protein fa... Lus10036654 19.6 0.5315
Lus10011766 20.7 0.5659
Lus10015034 26.3 0.5692
AT5G59380 MBD6, ATMBD6 methyl-CPG-binding domain 6 (.... Lus10029564 31.1 0.5805
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10007117 31.9 0.5803
AT3G28630 Protein of unknown function (D... Lus10001124 34.6 0.6089

Lus10027183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.