Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62040 199 / 2e-67 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT2G05630 197 / 1e-66 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 187 / 2e-62 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT4G04620 182 / 1e-60 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT4G16520 178 / 2e-59 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT3G60640 172 / 7e-57 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) AT2G45170 166 / 1e-54 ATATG8E AUTOPHAGY 8E (.1.2) AT3G15580 130 / 3e-40 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 125 / 2e-38 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015563 [exp] 198 / 3e-67 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 192 / 9e-64 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10008507 [exp] 177 / 1e-58 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10000733 [exp] 176 / 3e-58 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10028933 [exp] 175 / 5e-58 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 169 / 2e-55 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2) Lus10038046 [exp] 133 / 2e-41 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Lus10009987 [exp] 122 / 4e-33 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G228800 [exp] 205 / 6e-70 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.014G153800 [exp] 205 / 8e-70 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.004G013700 [exp] 191 / 2e-64 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 188 / 6e-63 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.002G144600 [exp] 181 / 2e-60 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.001G122700 [exp] 180 / 7e-60 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.003G110901 [exp] 180 / 7e-60 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.008G136040 [exp] 180 / 7e-60 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G060300 [exp] 172 / 8e-57 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.008G099400 [exp] 134 / 6e-42 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10027186 pacid=23145556 polypeptide=Lus10027186 locus=Lus10027186.g ID=Lus10027186.BGIv1.0 annot-version=v1.0 ATGGTCCAGAGCTCCTTCAAGCTGGAACATCCCCTCGAGAGGAGGCAGGCTGAAGCTGCTCGCATTAGGGAGAAATATCCAGACAGAATTCCAGTGATTG TTGAGAGGGCTGAAAAGAGCGATGTGCCCGACATTGACAAGAAGAAATACTTGGTTCCTGCTGATCTCACCGTTGGCCAATTCGTGTACGTAGTCCGGAA AAGGATCAAGCTGAGTCCCGAGAAAGCCATCTTCATTTTCGTCAAGAACATTCTACCTCCCACCGCTGCTATGATGGCCGCAATCTACGAAGAGAACAAG GACGAGGATGGCTTCCTTTACATGACCTACAGCGGGGAGAACACCTTTGGAAAAGACCTCTGA
AA sequence Show only first row Show all	>Lus10027186 pacid=23145556 polypeptide=Lus10027186 locus=Lus10027186.g ID=Lus10027186.BGIv1.0 annot-version=v1.0 MVQSSFKLEHPLERRQAEAARIREKYPDRIPVIVERAEKSDVPDIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMAAIYEENK DEDGFLYMTYSGENTFGKDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Lus10027186 [exp]	0	1
AT1G08110			lactoylglutathione lyase famil...		Lus10016138 [exp]	1.0	0.9565
AT1G44170		ALDH4, ALDH3H1	aldehyde dehydrogenase 4, alde...		Lus10042724 [exp]	1.4	0.9522
AT4G39870			TLD-domain containing nucleola...		Lus10041697 [exp]	2.4	0.9498
					Lus10021689 [exp]	5.7	0.9373
AT1G02860		BAH1, NLA	nitrogen limitation adaptation...		Lus10030375 [exp]	6.7	0.9429
AT1G78895			Reticulon family protein (.1)		Lus10033352 [exp]	8.5	0.9386
AT5G49710			unknown protein		Lus10015965 [exp]	9.4	0.9464
AT3G61540			alpha/beta-Hydrolases superfam...		Lus10001877 [exp]	10.4	0.9217
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10032097 [exp]	10.4	0.8979
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10034468 [exp]	12.0	0.9367

Compare expression of checked genes

Lus10027186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.