Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039655 [exp] 110 / 2e-33 ND 37 / 2e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G153900 [exp] 58 / 9e-13 AT1G19020 40 / 1e-05 unknown protein Potri.011G004400 [exp] 37 / 8e-05 AT1G62045 47 / 2e-08 unknown protein Potri.004G013601 [exp] 37 / 0.0002 AT1G62045 52 / 1e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027187 pacid=23145471 polypeptide=Lus10027187 locus=Lus10027187.g ID=Lus10027187.BGIv1.0 annot-version=v1.0 ATGGCGAGCAAAGCACCGAGCTGGTCGGAGCAGTGGGGGAGCTACGAGATGCAGGATAGAAATGATGATGATCTAGCGACGTCGGAGAAGAAAGGAAAGA AGATGGCGGATGTGAAATCGGCAGCGTCGGCTGGACTGGACAAGGCTAAGTCTGCAGCGACTGCTGGTGCGTCGAAGATGAAGAGTGGGACTTCTGTTGG GATCAAGTGGGTGAAGAAACAGTACAGCAAGAAGTTCTCTTCTTGA
AA sequence Show only first row Show all	>Lus10027187 pacid=23145471 polypeptide=Lus10027187 locus=Lus10027187.g ID=Lus10027187.BGIv1.0 annot-version=v1.0 MASKAPSWSEQWGSYEMQDRNDDDLATSEKKGKKMADVKSAASAGLDKAKSAATAGASKMKSGTSVGIKWVKKQYSKKFSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48180			unknown protein		Lus10027187 [exp]	0	1
AT4G14710		ATARD2	RmlC-like cupins superfamily p...		Lus10039375 [exp]	2.8	0.9051
AT2G05830			NagB/RpiA/CoA transferase-like...		Lus10008417 [exp]	7.1	0.8750
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10022357 [exp]	13.2	0.9043
AT4G14710		ATARD2	RmlC-like cupins superfamily p...		Lus10006617 [exp]	21.6	0.8953
AT3G61710		AtBECLIN1, ATAT...	BECLIN1, AUTOPHAGY 6 (.1.2.3)		Lus10012632 [exp]	27.6	0.8724
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10011202 [exp]	34.0	0.8707
AT5G41560			unknown protein		Lus10028758 [exp]	41.6	0.8191
AT5G51040			unknown protein		Lus10032526 [exp]	47.8	0.7916
AT5G46250			RNA-binding protein (.1.2.3)		Lus10038494 [exp]	54.5	0.8423
AT1G65520		PEC11, ECHIC, A...	"delta\(3\), delta\(2\)-enoyl ...		Lus10001701 [exp]	65.2	0.8496

Compare expression of checked genes

Lus10027187 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.