Gene [FLAX] | FIBexDB

Lus10027188 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT1G65560	39 / 0.0002			Zinc-binding dehydrogenase family protein (.1)
AT5G16980	37 / 0.001			Zinc-binding dehydrogenase family protein (.1.2)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10035274 [exp]	129 / 2e-37	AT5G16970	229 / 1e-72	alkenal reductase (.1)
Lus10004380 [exp]	42 / 2e-05	AT5G37980	477 / 4e-170	Zinc-binding dehydrogenase family protein (.1)
Lus10040177 [exp]	40 / 0.0001	AT5G37980	480 / 3e-171	Zinc-binding dehydrogenase family protein (.1)
Lus10007853 [exp]	39 / 0.0003	AT5G16990	468 / 3e-166	Zinc-binding dehydrogenase family protein (.1)
Lus10010989 [exp]	37 / 0.001	AT5G16990	483 / 2e-172	Zinc-binding dehydrogenase family protein (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.017G002300 [exp]	39 / 0.0002	AT1G26320	488 / 2e-174	Zinc-binding dehydrogenase family protein (.1.2)
Potri.017G006000 [exp]	39 / 0.0003	AT5G37980	493 / 2e-176	Zinc-binding dehydrogenase family protein (.1)
Potri.017G002950 [exp]	39 / 0.0003	AT5G16970	464 / 7e-165	alkenal reductase (.1)
Potri.017G005700 [exp]	38 / 0.0004	AT1G26320	496 / 1e-176	Zinc-binding dehydrogenase family protein (.1.2)
Potri.017G004600 [exp]	37 / 0.0006	AT5G37980	419 / 7e-148	Zinc-binding dehydrogenase family protein (.1)
Potri.010G177700 [exp]	37 / 0.0006	AT1G65560	514 / 0.0	Zinc-binding dehydrogenase family protein (.1)
Potri.006G070000 [exp]	37 / 0.0007	AT5G16990	341 / 1e-116	Zinc-binding dehydrogenase family protein (.1)
Potri.017G002500 [exp]	37 / 0.0008	AT3G03080	433 / 1e-152	Zinc-binding dehydrogenase family protein (.1)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10027188 pacid=23145363 polypeptide=Lus10027188 locus=Lus10027188.g ID=Lus10027188.BGIv1.0 annot-version=v1.0

ATGAGGAATTTGCTCAACATGATTGGTAAAGAAGTGAAGATGGAAGGGTTTCTACTTGATCCCTACCTCAATGTTTTTGGAGACTTTGCGAAGGAGATGG

AAGGCTATATTGTCGAAGGAAAGATTCGGTCCAAGTATAAAGTTTACGATGGGATCGAGAGCTTTCTGGAAGGGTTTGGATCTGTTTCCTCAAACGTTAA

TGACGGAAAAGTTGTCATCAAAGCTGGTTCTTCTCACGTGATCAAGGAAATTTCTGAGGAGGAAAGTAAGGCAATGAGTATGGCAAAAATGACTATGATG

TGA

AA sequence

Show only first row Show all

>Lus10027188 pacid=23145363 polypeptide=Lus10027188 locus=Lus10027188.g ID=Lus10027188.BGIv1.0 annot-version=v1.0

MRNLLNMIGKEVKMEGFLLDPYLNVFGDFAKEMEGYIVEGKIRSKYKVYDGIESFLEGFGSVSSNVNDGKVVIKAGSSHVIKEISEEESKAMSMAKMTMM

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65560			Zinc-binding dehydrogenase fam...		Lus10027188 [exp]	0	1

Lus10027188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.