Lus10027194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62300 196 / 7e-66 Ribosomal protein S10p/S20e family protein (.1.2)
AT3G45030 196 / 7e-66 Ribosomal protein S10p/S20e family protein (.1)
AT3G47370 194 / 4e-65 Ribosomal protein S10p/S20e family protein (.1.2.3)
AT3G13120 48 / 2e-07 Ribosomal protein S10p/S20e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038910 214 / 2e-73 AT5G62300 210 / 8e-72 Ribosomal protein S10p/S20e family protein (.1.2)
Lus10031705 209 / 4e-71 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2)
Lus10031126 204 / 5e-69 AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1)
Lus10031706 202 / 3e-68 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1)
Lus10031125 126 / 1e-38 AT5G62300 113 / 6e-34 Ribosomal protein S10p/S20e family protein (.1.2)
Lus10016604 49 / 1e-07 AT3G13120 240 / 3e-81 Ribosomal protein S10p/S20e family protein (.1.2)
Lus10007111 47 / 6e-07 AT3G13120 226 / 3e-75 Ribosomal protein S10p/S20e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G129800 192 / 6e-64 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2)
Potri.012G128300 189 / 3e-63 AT5G62300 222 / 2e-76 Ribosomal protein S10p/S20e family protein (.1.2)
Potri.002G146600 181 / 3e-60 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3)
Potri.002G116900 108 / 4e-32 AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3)
Potri.001G365600 49 / 1e-07 AT3G13120 237 / 4e-80 Ribosomal protein S10p/S20e family protein (.1.2)
Potri.011G092800 48 / 2e-07 AT3G13120 231 / 1e-77 Ribosomal protein S10p/S20e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence
>Lus10027194 pacid=23145588 polypeptide=Lus10027194 locus=Lus10027194.g ID=Lus10027194.BGIv1.0 annot-version=v1.0
ATGGCAGCATACGCAGCAGTGAAGCAGGCAAAGGCAGGGCTAGAAGAGCCAGAGAACCAAATCCACAAGATCAGGATTACACTCAGCTCCAAGAATGTGA
AGAACCTCGAGAAAGTCTGTGGAGATTTGATCCGTGGAGCTAAGGACAAGATGTTGAGGGTGAAGGGACCAGTCAGGATGCCTACCAAGACTCTGCTTAT
CACCACTAGGAAGTCTCCTTGTGGAGAAGCGATGAATTGTTCTACTCACCTTATCCATGCCCTCGTTTTAGGAACGAACACCTTTGACAGATTCGAGCTG
CGAGTCCACAAGCGTGTGATTGACCTCTTCAGCTCCCCGGATGTGGTGAAGCAGATCACCTCAATTACAATCGAGCCTGGTGTCGAGGTCGAAGTCACCA
TCGCTGACGCATAA
AA sequence
>Lus10027194 pacid=23145588 polypeptide=Lus10027194 locus=Lus10027194.g ID=Lus10027194.BGIv1.0 annot-version=v1.0
MAAYAAVKQAKAGLEEPENQIHKIRITLSSKNVKNLEKVCGDLIRGAKDKMLRVKGPVRMPTKTLLITTRKSPCGEAMNCSTHLIHALVLGTNTFDRFEL
RVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10027194 0 1
AT4G18100 Ribosomal protein L32e (.1) Lus10004589 1.7 0.8800
AT3G23620 Ribosomal RNA processing Brix ... Lus10035575 7.2 0.8503
AT3G11510 Ribosomal protein S11 family p... Lus10014220 7.2 0.8481
AT2G44860 Ribosomal protein L24e family ... Lus10009403 8.5 0.8354
AT1G26880 Ribosomal protein L34e superfa... Lus10008617 9.2 0.8467
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10043248 11.3 0.8099
AT1G41880 Ribosomal protein L35Ae family... Lus10040235 11.8 0.8391
AT1G34030 Ribosomal protein S13/S18 fami... Lus10034179 12.2 0.8496
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10019881 13.6 0.8370
AT2G01640 unknown protein Lus10027869 14.5 0.7264

Lus10027194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.