Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62350 185 / 8e-60 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 179 / 2e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 169 / 2e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 157 / 9e-49 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 157 / 1e-48 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62360 150 / 5e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 139 / 1e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 129 / 1e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 130 / 5e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 124 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038914 [exp] 323 / 3e-114 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 220 / 2e-73 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 210 / 2e-69 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 162 / 9e-51 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024593 [exp] 147 / 7e-45 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 142 / 5e-43 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 138 / 4e-41 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 130 / 4e-38 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 129 / 1e-37 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128700 [exp] 218 / 1e-72 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 216 / 6e-72 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 171 / 3e-54 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128300 [exp] 149 / 8e-46 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 149 / 9e-46 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 145 / 4e-44 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 142 / 7e-43 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 136 / 2e-40 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 134 / 1e-39 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G145800 [exp] 130 / 4e-38 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10027198 pacid=23145560 polypeptide=Lus10027198 locus=Lus10027198.g ID=Lus10027198.BGIv1.0 annot-version=v1.0 ATGGCGACCAAACCCAACTCCCAAACCCTCTTCATAACCATATCAACCTTCCTCCTCCTCGCCACAACCACCTTAACCGCCGCCGACTTCATCAAAACCT CCTGCGCCGCCACAACATACCCATCCCTCTGCATCCACTCGCTCACCCCTTACGCGCCCGCCATCAAAACCTCCACGCGCCGCCTAGCCATCACCGCACT AACCGTCAGCCTCTCCACCGCCCAGTCGACCAAATCCTACGTCCGCAAGCTGCAGCCGTCAAAGCCGAGGGAAGCCGCCGCCGTGAAGGACTGCGCCGAG GAGATCGAGGACACCGTGGACCGGCTGAGCCGGTCGATCAAGGAGCTGAAGGCGATGGGCGCAAGTGGGGAGGAGTTCCAGTGGCATTTGAGTAATATCG AGACGTGGGTCAGCGCTGCGTTGACCGACGAGAATACTTGCGTTGATGGGTTTGGTGGGAAAGTTATGGATGGGGAGATGAAGGATGAGATAAGGGTTAG GTTTCTGAGGACTGCTAGAGTTACTAGTAATGCTCTGGCTTTGATTAATAAGTTCGGCCGCCGCCATTGA
AA sequence Show only first row Show all	>Lus10027198 pacid=23145560 polypeptide=Lus10027198 locus=Lus10027198.g ID=Lus10027198.BGIv1.0 annot-version=v1.0 MATKPNSQTLFITISTFLLLATTTLTAADFIKTSCAATTYPSLCIHSLTPYAPAIKTSTRRLAITALTVSLSTAQSTKSYVRKLQPSKPREAAAVKDCAE EIEDTVDRLSRSIKELKAMGASGEEFQWHLSNIETWVSAALTDENTCVDGFGGKVMDGEMKDEIRVRFLRTARVTSNALALINKFGRRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62350			Plant invertase/pectin methyle...		Lus10027198 [exp]	0	1
AT5G07900			Mitochondrial transcription te...		Lus10016550 [exp]	1.0	0.8720
AT5G16150		PGLCT, GLT1	GLUCOSE TRANSPORTER 1, plastid...		Lus10028486 [exp]	6.6	0.8236
AT1G77590		LACS9	long chain acyl-CoA synthetase...		Lus10042707 [exp]	8.0	0.8558
AT1G74160			unknown protein		Lus10034678 [exp]	9.4	0.8322
AT2G18410			unknown protein		Lus10009164 [exp]	13.5	0.8188
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10003807 [exp]	14.3	0.8449
AT5G13100			unknown protein		Lus10037045 [exp]	14.3	0.8395
AT1G76190			SAUR-like auxin-responsive pro...		Lus10021825 [exp]	17.2	0.7462
AT3G55610		P5CS2	delta 1-pyrroline-5-carboxylat...		Lus10030158 [exp]	18.7	0.7921
AT2G05990		ENR1, MOD1	MOSAIC DEATH 1, ENOYL-ACP REDU...		Lus10004186 [exp]	18.7	0.8345

Compare expression of checked genes

Lus10027198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.