Lus10027199 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62360 126 / 2e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 120 / 5e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 111 / 2e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 100 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 97 / 5e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 97 / 5e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 96 / 1e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 94 / 7e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 90 / 3e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G70720 87 / 2e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038915 270 / 5e-93 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 151 / 3e-46 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031717 137 / 2e-40 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 124 / 1e-35 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 122 / 7e-35 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 120 / 3e-34 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 120 / 9e-34 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 113 / 1e-31 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 112 / 1e-30 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128200 158 / 4e-49 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 154 / 3e-47 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 151 / 4e-46 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 122 / 5e-35 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 119 / 7e-34 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 119 / 9e-34 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 113 / 3e-31 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 107 / 3e-29 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.012G127400 105 / 2e-28 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 104 / 4e-28 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10027199 pacid=23145401 polypeptide=Lus10027199 locus=Lus10027199.g ID=Lus10027199.BGIv1.0 annot-version=v1.0
ATGGCATCAACTTCCTCCTCCTCCGCCGCCGCATTCCTCACCATACTACTAATCTCCTCCACCACCACCGTCATCTCCTCCCCCGCCGCCACAACCAATA
CCGAGTTCGTCCGCACATCATGCACAGCCACAACCTACCCAAAGCTCTGCTACGCCTCCCTATCAATCCACGCCGCCAAAATCCAGTCAAGCTCCAAGCT
CCTGGCCGCCGCCGCACTAGACGTCACCCTCACCTCCGCGAAATCCTCGTCCTCCGCCATGTCAAAGCTCTCACGTGACCACGGCCTCCTGCCACGTGAG
TCAGCCGCCATGAAGGACTGCGTGGAGGAGATGCATGACTCCGTCGACCAGCTCCGCCGCTCCATCGACGAGTTCGAATCAACTACGACGAAGCCCGCCG
ATCTCGAGATGATGATCAGCGACGTGCAGACGTGGGTCAGCGCCGCGTTGACCGACGAGGGCACGTGCATGGATGGGTTTTCGACTTCCGGTAAGGCGGC
GTCGGCGGTGAAGGAGGTGGTGAGAGGGAAGGTGGAGAAGATTGTTCATCTTACTAGTAATGCTTTGGCTTTGGTTAATTGCTATGCTAATTCTCTTCGT
AATTAG
AA sequence
>Lus10027199 pacid=23145401 polypeptide=Lus10027199 locus=Lus10027199.g ID=Lus10027199.BGIv1.0 annot-version=v1.0
MASTSSSSAAAFLTILLISSTTTVISSPAATTNTEFVRTSCTATTYPKLCYASLSIHAAKIQSSSKLLAAAALDVTLTSAKSSSSAMSKLSRDHGLLPRE
SAAMKDCVEEMHDSVDQLRRSIDEFESTTTKPADLEMMISDVQTWVSAALTDEGTCMDGFSTSGKAASAVKEVVRGKVEKIVHLTSNALALVNCYANSLR
N

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62360 Plant invertase/pectin methyle... Lus10027199 0 1
AT2G27310 F-box family protein (.1) Lus10028024 1.7 0.8687
AT5G67390 unknown protein Lus10011080 2.4 0.8636
AT4G03140 NAD(P)-binding Rossmann-fold s... Lus10005927 7.7 0.7924
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10037551 14.1 0.8027
AT5G15070 Phosphoglycerate mutase-like f... Lus10008307 16.2 0.7808
AT5G62360 Plant invertase/pectin methyle... Lus10038915 18.3 0.7910
AT4G03510 ATRMA1, RMA1 RING membrane-anchor 1 (.1.2) Lus10039821 19.3 0.8055
AT5G49350 Glycine-rich protein family (.... Lus10037727 20.5 0.7361
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041674 21.0 0.7506
AT2G39890 ATPROT1, ProT1 proline transporter 1 (.1.2) Lus10009877 33.1 0.7643

Lus10027199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.