Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25225 82 / 7e-23 unknown protein AT2G35736 76 / 1e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038922 [exp] 115 / 2e-35 AT4G25225 81 / 2e-21 unknown protein Lus10028935 [exp] 74 / 8e-20 AT2G35736 96 / 2e-28 unknown protein Lus10004354 [exp] 74 / 2e-19 AT2G35736 95 / 4e-28 unknown protein Lus10000732 [exp] 57 / 6e-13 AT2G35736 73 / 1e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124100 [exp] 88 / 3e-25 AT4G25225 90 / 6e-26 unknown protein Potri.014G059600 [exp] 75 / 4e-20 AT4G25225 87 / 8e-25 unknown protein Potri.001G123000 [exp] 73 / 3e-19 AT2G35736 91 / 1e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027209 pacid=23145539 polypeptide=Lus10027209 locus=Lus10027209.g ID=Lus10027209.BGIv1.0 annot-version=v1.0 ATGGGAATAATCCGTACTTACTTCTCCTTCATCGTCGGCACTGTTTCGGGGATCTACATCGCGCAGAACTACGACGTTCCGAACATCAAGAAGGTGGTGA ACTCCGCGCTCTTCACCGCCAAAGTTGTCGAGGAGAAGTACCGGAAGCCCAAGAGTGGCAAAGATGATGTTTAG
AA sequence Show only first row Show all	>Lus10027209 pacid=23145539 polypeptide=Lus10027209 locus=Lus10027209.g ID=Lus10027209.BGIv1.0 annot-version=v1.0 MGIIRTYFSFIVGTVSGIYIAQNYDVPNIKKVVNSALFTAKVVEEKYRKPKSGKDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25225			unknown protein		Lus10027209 [exp]	0	1
AT1G80180			unknown protein		Lus10030064 [exp]	7.6	0.9165
AT5G40650		SDH2-2	succinate dehydrogenase 2-2 (....		Lus10022319 [exp]	14.9	0.9115
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10036023 [exp]	18.0	0.9119
AT5G53850			haloacid dehalogenase-like hyd...		Lus10009198 [exp]	25.5	0.9147
AT1G03070			Bax inhibitor-1 family protein...		Lus10022085 [exp]	27.5	0.9008
AT2G35736			unknown protein		Lus10004354 [exp]	28.6	0.8795
AT1G80600		WIN1	HOPW1-1-interacting 1 (.1)		Lus10031196 [exp]	31.0	0.8892
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10042662 [exp]	34.9	0.9113
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Lus10028823 [exp]	36.9	0.8819
AT4G03320		AtTic20-IV, TIC...	translocon at the inner envelo...		Lus10039783 [exp]	41.7	0.8896

Compare expression of checked genes

Lus10027209 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.